Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   EHQ66_RS13700 Genome accession   NZ_CP034091
Coordinates   2918341..2918877 (+) Length   178 a.a.
NCBI ID   WP_124743650.1    Uniprot ID   -
Organism   Proteus mirabilis strain PmBC1123     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2883665..2925320 2918341..2918877 within 0


Gene organization within MGE regions


Location: 2883665..2925320
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EHQ66_RS13445 (EHQ66_13445) - 2883665..2883895 (+) 231 WP_124743762.1 DNA polymerase III subunit theta -
  EHQ66_RS13450 (EHQ66_13450) - 2883909..2884979 (-) 1071 WP_124743763.1 acyltransferase -
  EHQ66_RS19420 - 2885074..2887332 (-) 2259 WP_241158613.1 phage head-binding domain-containing protein -
  EHQ66_RS13460 (EHQ66_13460) - 2887446..2889389 (-) 1944 WP_124743764.1 lytic transglycosylase domain-containing protein -
  EHQ66_RS19425 (EHQ66_13465) - 2889374..2890942 (-) 1569 WP_124743959.1 phage DNA ejection protein -
  EHQ66_RS13470 (EHQ66_13470) - 2890952..2891611 (-) 660 WP_102086755.1 DNA transfer protein -
  EHQ66_RS13475 (EHQ66_13475) - 2891605..2892066 (-) 462 WP_124743765.1 DUF2824 family protein -
  EHQ66_RS13480 (EHQ66_13480) - 2892066..2892764 (-) 699 WP_124743960.1 phage tail protein -
  EHQ66_RS13485 (EHQ66_13485) - 2892764..2894545 (-) 1782 WP_241158614.1 packaged DNA stabilization protein -
  EHQ66_RS13495 (EHQ66_13495) - 2894517..2894999 (-) 483 WP_124743766.1 packaged DNA stabilization gp4 family protein -
  EHQ66_RS13500 (EHQ66_13500) - 2894980..2895171 (-) 192 WP_124743767.1 hypothetical protein -
  EHQ66_RS13505 (EHQ66_13505) - 2895225..2896496 (-) 1272 WP_124743768.1 P22 phage major capsid protein family protein -
  EHQ66_RS13510 (EHQ66_13510) - 2896511..2897410 (-) 900 WP_124743769.1 phage capsid protein -
  EHQ66_RS13515 (EHQ66_13515) - 2897421..2899622 (-) 2202 WP_124743770.1 portal protein -
  EHQ66_RS13520 (EHQ66_13520) - 2899625..2901037 (-) 1413 WP_124743771.1 PBSX family phage terminase large subunit -
  EHQ66_RS13525 (EHQ66_13525) - 2901039..2901461 (-) 423 WP_124743772.1 ubiquitin carboxyl-hydrolase -
  EHQ66_RS13530 (EHQ66_13530) - 2901517..2901744 (-) 228 WP_071233446.1 DUF2560 family protein -
  EHQ66_RS13540 (EHQ66_13540) - 2902212..2902592 (-) 381 WP_124743774.1 hypothetical protein -
  EHQ66_RS13545 (EHQ66_13545) - 2902589..2902981 (-) 393 WP_124743775.1 M15 family metallopeptidase -
  EHQ66_RS13550 (EHQ66_13550) - 2902974..2903291 (-) 318 WP_064497293.1 phage holin, lambda family -
  EHQ66_RS13555 (EHQ66_13555) - 2903952..2904455 (-) 504 WP_036969493.1 antiterminator Q family protein -
  EHQ66_RS13565 (EHQ66_13565) - 2904667..2905287 (-) 621 WP_124743776.1 recombination protein NinG -
  EHQ66_RS13570 (EHQ66_13570) - 2905561..2905920 (-) 360 WP_124743777.1 hypothetical protein -
  EHQ66_RS13575 (EHQ66_13575) - 2905941..2906387 (-) 447 WP_124743778.1 recombination protein NinB -
  EHQ66_RS13580 (EHQ66_13580) - 2906389..2906610 (-) 222 WP_241158615.1 hypothetical protein -
  EHQ66_RS13590 (EHQ66_13590) - 2906879..2907127 (-) 249 WP_124743779.1 DUF551 domain-containing protein -
  EHQ66_RS13595 (EHQ66_13595) - 2907114..2907335 (-) 222 WP_064497301.1 hypothetical protein -
  EHQ66_RS13600 (EHQ66_13600) - 2907335..2907601 (-) 267 WP_124743780.1 hypothetical protein -
  EHQ66_RS13605 (EHQ66_13605) - 2907633..2907836 (-) 204 WP_124743781.1 hypothetical protein -
  EHQ66_RS13610 (EHQ66_13610) - 2907837..2908172 (-) 336 WP_124743782.1 hypothetical protein -
  EHQ66_RS13615 (EHQ66_13615) - 2908196..2909563 (-) 1368 WP_124743963.1 replicative DNA helicase -
  EHQ66_RS13620 (EHQ66_13620) - 2909567..2910403 (-) 837 WP_124743783.1 replication protein -
  EHQ66_RS19080 - 2910396..2910572 (-) 177 WP_164484703.1 hypothetical protein -
  EHQ66_RS13625 (EHQ66_13625) - 2910668..2911009 (-) 342 WP_036935825.1 CII family transcriptional regulator -
  EHQ66_RS13630 (EHQ66_13630) - 2911141..2911368 (-) 228 WP_049216808.1 helix-turn-helix domain-containing protein -
  EHQ66_RS13635 (EHQ66_13635) - 2911447..2912124 (+) 678 WP_124743964.1 LexA family transcriptional regulator -
  EHQ66_RS13640 (EHQ66_13640) - 2912151..2912558 (+) 408 WP_071233854.1 hypothetical protein -
  EHQ66_RS13645 (EHQ66_13645) - 2913174..2913368 (+) 195 WP_241158616.1 hypothetical protein -
  EHQ66_RS13650 (EHQ66_13650) - 2913379..2913564 (+) 186 WP_124743656.1 hypothetical protein -
  EHQ66_RS19085 - 2913624..2913791 (+) 168 WP_159290196.1 hypothetical protein -
  EHQ66_RS13655 (EHQ66_13655) - 2913816..2914004 (+) 189 WP_109395762.1 hypothetical protein -
  EHQ66_RS19090 - 2914021..2914167 (+) 147 WP_164484797.1 hypothetical protein -
  EHQ66_RS19535 - 2914391..2914513 (+) 123 WP_261190402.1 hypothetical protein -
  EHQ66_RS13665 (EHQ66_13665) - 2914641..2914919 (+) 279 WP_124743654.1 hypothetical protein -
  EHQ66_RS13670 (EHQ66_13670) - 2914982..2915551 (+) 570 WP_124743653.1 hypothetical protein -
  EHQ66_RS13675 (EHQ66_13675) - 2915772..2916047 (+) 276 WP_063693270.1 hypothetical protein -
  EHQ66_RS13680 (EHQ66_13680) - 2916062..2916510 (+) 449 Protein_2625 SAM-dependent methyltransferase -
  EHQ66_RS13685 (EHQ66_13685) - 2916558..2916761 (+) 204 WP_063108486.1 hypothetical protein -
  EHQ66_RS13690 (EHQ66_13690) - 2916758..2917339 (+) 582 Protein_2627 RecT family recombinase -
  EHQ66_RS19540 - 2917520..2917645 (+) 126 WP_277424526.1 hypothetical protein -
  EHQ66_RS13695 (EHQ66_13695) - 2917658..2918351 (+) 694 Protein_2629 lambda exonuclease family protein -
  EHQ66_RS13700 (EHQ66_13700) ssb 2918341..2918877 (+) 537 WP_124743650.1 single-stranded DNA-binding protein Machinery gene
  EHQ66_RS13705 (EHQ66_13705) - 2918893..2919180 (+) 288 WP_124743649.1 hypothetical protein -
  EHQ66_RS13710 (EHQ66_13710) - 2919200..2919439 (+) 240 WP_071425894.1 hypothetical protein -
  EHQ66_RS13715 (EHQ66_13715) - 2919479..2919772 (+) 294 WP_124743648.1 hypothetical protein -
  EHQ66_RS13720 (EHQ66_13720) - 2919865..2920371 (+) 507 WP_124743647.1 hypothetical protein -
  EHQ66_RS13725 (EHQ66_13725) - 2920590..2920802 (+) 213 WP_124743646.1 hypothetical protein -
  EHQ66_RS13735 (EHQ66_13735) - 2921108..2921710 (+) 603 WP_124743786.1 MT-A70 family methyltransferase -
  EHQ66_RS13745 (EHQ66_13745) - 2922146..2923303 (+) 1158 WP_063073711.1 site-specific integrase -
  EHQ66_RS13755 (EHQ66_13755) folD 2923592..2924464 (+) 873 WP_060554830.1 bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD -
  EHQ66_RS13760 (EHQ66_13760) ybcJ 2924468..2924680 (+) 213 WP_060556405.1 ribosome-associated protein YbcJ -

Sequence


Protein


Download         Length: 178 a.a.        Molecular weight: 19575.98 Da        Isoelectric Point: 6.7213

>NTDB_id=328854 EHQ66_RS13700 WP_124743650.1 2918341..2918877(+) (ssb) [Proteus mirabilis strain PmBC1123]
MASKGVNKCILIGHLGQDPEIRYMPSGGAVANLTLATSESWRDKQTGEMKEKTEWHRVVIFGKLAETAGEYLRKGSQVYI
EGSLQTRKWTDQSGQDRYTTEVVVNIGGTMQMLGGNGGNQAGSQKPQNQGWGQPQQPQAPKQVSSNQAPQSEPTMDFDDD
IPFAPIVLPYPRHAIYVI

Nucleotide


Download         Length: 537 bp        

>NTDB_id=328854 EHQ66_RS13700 WP_124743650.1 2918341..2918877(+) (ssb) [Proteus mirabilis strain PmBC1123]
ATGGCAAGTAAAGGCGTGAATAAATGTATTCTCATTGGTCACTTGGGTCAGGATCCGGAAATCCGCTATATGCCATCAGG
TGGCGCAGTAGCAAATCTCACACTAGCCACATCGGAATCGTGGCGCGATAAGCAGACTGGTGAGATGAAGGAGAAAACCG
AGTGGCATCGCGTGGTAATTTTCGGCAAATTAGCCGAAACTGCAGGTGAATATCTGAGAAAAGGAAGTCAGGTATACATA
GAAGGTTCTCTGCAAACCAGAAAATGGACAGACCAAAGCGGTCAAGACAGATACACAACGGAAGTGGTGGTTAATATCGG
CGGTACGATGCAAATGCTAGGCGGTAACGGTGGTAATCAGGCAGGAAGCCAGAAGCCACAAAACCAAGGATGGGGCCAAC
CTCAGCAACCGCAAGCACCAAAACAAGTATCGAGCAATCAAGCACCACAAAGTGAACCTACGATGGATTTCGATGATGAC
ATCCCCTTCGCCCCTATCGTACTCCCCTACCCACGCCACGCTATTTATGTGATTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

70.056

99.438

0.697

  ssb Glaesserella parasuis strain SC1401

52.128

100

0.551

  ssb Neisseria gonorrhoeae MS11

43.258

100

0.433

  ssb Neisseria meningitidis MC58

43.258

100

0.433


Multiple sequence alignment