Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   EHU52_RS00720 Genome accession   NZ_CP034071
Coordinates   147662..147787 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori strain Hpbs1     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 142662..152787
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EHU52_RS00695 - 142727..144946 (+) 2220 WP_124732811.1 ATP-dependent Clp protease ATP-binding subunit -
  EHU52_RS00700 panD 144936..145286 (+) 351 WP_124732812.1 aspartate 1-decarboxylase -
  EHU52_RS00705 - 145297..145590 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  EHU52_RS00710 - 145590..146585 (+) 996 WP_124733666.1 PDZ domain-containing protein -
  EHU52_RS00715 comB6 146591..147646 (+) 1056 WP_124733665.1 P-type conjugative transfer protein TrbL Machinery gene
  EHU52_RS00720 comB7 147662..147787 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  EHU52_RS00725 comB8 147784..148521 (+) 738 WP_075708163.1 virB8 family protein Machinery gene
  EHU52_RS00730 comB9 148521..149483 (+) 963 WP_124732813.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  EHU52_RS00735 comB10 149476..150612 (+) 1137 WP_124732814.1 DNA type IV secretion system protein ComB10 Machinery gene
  EHU52_RS00740 - 150682..152094 (+) 1413 WP_124732815.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=328691 EHU52_RS00720 WP_001217874.1 147662..147787(+) (comB7) [Helicobacter pylori strain Hpbs1]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=328691 EHU52_RS00720 WP_001217874.1 147662..147787(+) (comB7) [Helicobacter pylori strain Hpbs1]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTAAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878


Multiple sequence alignment