Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   EG219_RS11125 Genome accession   NZ_CP034037
Coordinates   2295682..2296059 (-) Length   125 a.a.
NCBI ID   WP_007408325.1    Uniprot ID   -
Organism   Bacillus velezensis strain BCSo1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2290682..2301059
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EG219_RS11085 (EG219_11085) - 2291180..2291974 (+) 795 WP_007408330.1 YqhG family protein -
  EG219_RS11090 (EG219_11090) sinI 2292151..2292324 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  EG219_RS11095 (EG219_11095) sinR 2292358..2292693 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  EG219_RS11100 (EG219_11100) - 2292741..2293526 (-) 786 WP_007408329.1 TasA family protein -
  EG219_RS11105 (EG219_11105) - 2293591..2294175 (-) 585 WP_007408328.1 signal peptidase I -
  EG219_RS11110 (EG219_11110) tapA 2294147..2294818 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  EG219_RS11115 (EG219_11115) - 2295077..2295406 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  EG219_RS11120 (EG219_11120) - 2295446..2295625 (-) 180 WP_003153093.1 YqzE family protein -
  EG219_RS11125 (EG219_11125) comGG 2295682..2296059 (-) 378 WP_007408325.1 competence type IV pilus minor pilin ComGG Machinery gene
  EG219_RS11130 (EG219_11130) comGF 2296060..2296560 (-) 501 WP_258566475.1 competence type IV pilus minor pilin ComGF -
  EG219_RS11135 (EG219_11135) comGE 2296469..2296783 (-) 315 WP_007408323.1 competence type IV pilus minor pilin ComGE -
  EG219_RS11140 (EG219_11140) comGD 2296767..2297204 (-) 438 WP_124693411.1 competence type IV pilus minor pilin ComGD Machinery gene
  EG219_RS11145 (EG219_11145) comGC 2297194..2297502 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  EG219_RS11150 (EG219_11150) comGB 2297507..2298544 (-) 1038 WP_007408321.1 competence type IV pilus assembly protein ComGB Machinery gene
  EG219_RS11155 (EG219_11155) comGA 2298531..2299601 (-) 1071 WP_007408320.1 competence type IV pilus ATPase ComGA Machinery gene
  EG219_RS11160 (EG219_11160) - 2299793..2300743 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14183.05 Da        Isoelectric Point: 9.7381

>NTDB_id=328544 EG219_RS11125 WP_007408325.1 2295682..2296059(-) (comGG) [Bacillus velezensis strain BCSo1]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWTGENLLQNGALLSSRHMTQGQRVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=328544 EG219_RS11125 WP_007408325.1 2295682..2296059(-) (comGG) [Bacillus velezensis strain BCSo1]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGACCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAGGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGGCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488

Multiple sequence alignment