Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | EG219_RS11090 | Genome accession | NZ_CP034037 |
| Coordinates | 2292151..2292324 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain BCSo1 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2287151..2297324
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EG219_RS11075 (EG219_11075) | gcvT | 2287964..2289064 (-) | 1101 | WP_007408332.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| EG219_RS11080 (EG219_11080) | - | 2289488..2291158 (+) | 1671 | WP_007408331.1 | SNF2-related protein | - |
| EG219_RS11085 (EG219_11085) | - | 2291180..2291974 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| EG219_RS11090 (EG219_11090) | sinI | 2292151..2292324 (+) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| EG219_RS11095 (EG219_11095) | sinR | 2292358..2292693 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| EG219_RS11100 (EG219_11100) | - | 2292741..2293526 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| EG219_RS11105 (EG219_11105) | - | 2293591..2294175 (-) | 585 | WP_007408328.1 | signal peptidase I | - |
| EG219_RS11110 (EG219_11110) | tapA | 2294147..2294818 (-) | 672 | WP_020954230.1 | amyloid fiber anchoring/assembly protein TapA | - |
| EG219_RS11115 (EG219_11115) | - | 2295077..2295406 (+) | 330 | WP_020954231.1 | DUF3889 domain-containing protein | - |
| EG219_RS11120 (EG219_11120) | - | 2295446..2295625 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| EG219_RS11125 (EG219_11125) | comGG | 2295682..2296059 (-) | 378 | WP_007408325.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| EG219_RS11130 (EG219_11130) | comGF | 2296060..2296560 (-) | 501 | WP_258566475.1 | competence type IV pilus minor pilin ComGF | - |
| EG219_RS11135 (EG219_11135) | comGE | 2296469..2296783 (-) | 315 | WP_007408323.1 | competence type IV pilus minor pilin ComGE | - |
| EG219_RS11140 (EG219_11140) | comGD | 2296767..2297204 (-) | 438 | WP_124693411.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=328542 EG219_RS11090 WP_003153105.1 2292151..2292324(+) (sinI) [Bacillus velezensis strain BCSo1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=328542 EG219_RS11090 WP_003153105.1 2292151..2292324(+) (sinI) [Bacillus velezensis strain BCSo1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |