Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | EFD68_RS10250 | Genome accession | NZ_CP034011 |
| Coordinates | 2070737..2071207 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934759.1 | Uniprot ID | A0A2I7Y8V1 |
| Organism | Staphylococcus aureus strain P1D5C1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2040419..2095624 | 2070737..2071207 | within | 0 |
Gene organization within MGE regions
Location: 2040419..2095624
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EFD68_RS10040 (EFD68_10490) | scn | 2040419..2040769 (-) | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
| EFD68_RS10045 (EFD68_10495) | - | 2041452..2041901 (+) | 450 | WP_000727645.1 | chemotaxis-inhibiting protein CHIPS | - |
| EFD68_RS10050 (EFD68_10500) | - | 2041996..2042333 (-) | 338 | Protein_1931 | SH3 domain-containing protein | - |
| EFD68_RS10055 (EFD68_10515) | sak | 2042977..2043468 (-) | 492 | WP_000920042.1 | staphylokinase | - |
| EFD68_RS10060 (EFD68_10520) | - | 2043659..2044414 (-) | 756 | WP_002955266.1 | CHAP domain-containing protein | - |
| EFD68_RS10065 (EFD68_10525) | - | 2044426..2044680 (-) | 255 | WP_000611512.1 | phage holin | - |
| EFD68_RS10070 (EFD68_10530) | - | 2044732..2044839 (+) | 108 | WP_031762631.1 | hypothetical protein | - |
| EFD68_RS10075 (EFD68_10535) | pepG1 | 2044892..2045026 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| EFD68_RS10080 (EFD68_10540) | sep | 2045271..2046053 (-) | 783 | WP_000034846.1 | staphylococcal enterotoxin type P | - |
| EFD68_RS10085 (EFD68_10545) | - | 2046465..2046839 (-) | 375 | WP_000340977.1 | hypothetical protein | - |
| EFD68_RS10090 (EFD68_10550) | - | 2046895..2047182 (-) | 288 | WP_001262621.1 | hypothetical protein | - |
| EFD68_RS10095 (EFD68_10555) | - | 2047228..2047380 (-) | 153 | WP_001000058.1 | hypothetical protein | - |
| EFD68_RS10100 (EFD68_10560) | - | 2047373..2051155 (-) | 3783 | WP_156668036.1 | phage tail spike protein | - |
| EFD68_RS10105 (EFD68_10565) | - | 2051171..2052655 (-) | 1485 | WP_000567396.1 | phage distal tail protein | - |
| EFD68_RS10110 (EFD68_10570) | - | 2052652..2057181 (-) | 4530 | WP_000504568.1 | phage tail tape measure protein | - |
| EFD68_RS14175 | gpGT | 2057238..2057375 (-) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| EFD68_RS10115 (EFD68_10575) | gpG | 2057426..2057776 (-) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| EFD68_RS10120 (EFD68_10580) | - | 2057826..2058056 (-) | 231 | Protein_1946 | Ig-like domain-containing protein | - |
| EFD68_RS10125 (EFD68_10585) | - | 2058092..2058736 (-) | 645 | WP_000268740.1 | major tail protein | - |
| EFD68_RS10130 (EFD68_10590) | - | 2058737..2059144 (-) | 408 | WP_000565498.1 | hypothetical protein | - |
| EFD68_RS10135 (EFD68_10595) | - | 2059141..2059545 (-) | 405 | WP_000114226.1 | HK97 gp10 family phage protein | - |
| EFD68_RS10140 (EFD68_10600) | - | 2059542..2059904 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| EFD68_RS10145 (EFD68_10605) | - | 2059888..2060172 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| EFD68_RS10150 (EFD68_10610) | - | 2060162..2060446 (-) | 285 | WP_000238236.1 | hypothetical protein | - |
| EFD68_RS10155 (EFD68_10615) | - | 2060466..2061611 (-) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| EFD68_RS10160 (EFD68_10620) | - | 2061635..2062372 (-) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| EFD68_RS10165 (EFD68_10625) | - | 2062356..2063543 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| EFD68_RS10170 (EFD68_10630) | - | 2063559..2065220 (-) | 1662 | WP_112380264.1 | terminase large subunit | - |
| EFD68_RS10175 (EFD68_10635) | - | 2065217..2065561 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| EFD68_RS10180 (EFD68_10640) | - | 2065691..2065990 (-) | 300 | WP_064125997.1 | HNH endonuclease | - |
| EFD68_RS10185 (EFD68_10645) | - | 2066222..2066638 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| EFD68_RS10190 (EFD68_10650) | - | 2066666..2066866 (-) | 201 | WP_001557462.1 | DUF1514 family protein | - |
| EFD68_RS10195 (EFD68_10655) | rinB | 2066866..2067015 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| EFD68_RS10200 (EFD68_10660) | - | 2067012..2067218 (-) | 207 | WP_000195784.1 | DUF1381 domain-containing protein | - |
| EFD68_RS10205 (EFD68_10665) | - | 2067215..2067460 (-) | 246 | WP_001282077.1 | hypothetical protein | - |
| EFD68_RS10210 (EFD68_10670) | - | 2067497..2068033 (-) | 537 | WP_000185693.1 | dUTPase | - |
| EFD68_RS10215 (EFD68_10675) | - | 2068030..2068275 (-) | 246 | WP_001065108.1 | DUF1024 family protein | - |
| EFD68_RS10220 (EFD68_10680) | - | 2068290..2068532 (-) | 243 | WP_000221877.1 | SAV1978 family virulence-associated passenger protein | - |
| EFD68_RS10225 (EFD68_10685) | - | 2068535..2068792 (-) | 258 | WP_000111491.1 | DUF3310 domain-containing protein | - |
| EFD68_RS10230 (EFD68_10690) | - | 2068792..2069163 (-) | 372 | WP_000101279.1 | SA1788 family PVL leukocidin-associated protein | - |
| EFD68_RS10235 (EFD68_10695) | - | 2069176..2069580 (-) | 405 | WP_000401969.1 | RusA family crossover junction endodeoxyribonuclease | - |
| EFD68_RS10240 (EFD68_10700) | - | 2069589..2069807 (-) | 219 | WP_000338528.1 | hypothetical protein | - |
| EFD68_RS10245 (EFD68_10705) | - | 2069814..2070707 (-) | 894 | WP_156668037.1 | DnaD domain protein | - |
| EFD68_RS10250 (EFD68_10710) | ssbA | 2070737..2071207 (-) | 471 | WP_000934759.1 | single-stranded DNA-binding protein | Machinery gene |
| EFD68_RS10255 (EFD68_10715) | - | 2071208..2071825 (-) | 618 | WP_064135358.1 | MBL fold metallo-hydrolase | - |
| EFD68_RS10260 (EFD68_10720) | - | 2071906..2072826 (-) | 921 | WP_000180600.1 | recombinase RecT | - |
| EFD68_RS10265 (EFD68_10725) | - | 2072828..2074764 (-) | 1937 | Protein_1975 | AAA family ATPase | - |
| EFD68_RS10270 (EFD68_10730) | - | 2074773..2075036 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| EFD68_RS10275 (EFD68_10735) | - | 2075045..2075305 (-) | 261 | WP_000291510.1 | DUF1108 family protein | - |
| EFD68_RS10280 (EFD68_10740) | - | 2075310..2075612 (-) | 303 | WP_000165371.1 | DUF2482 family protein | - |
| EFD68_RS10285 (EFD68_10745) | - | 2075707..2075868 (-) | 162 | WP_000048129.1 | DUF1270 family protein | - |
| EFD68_RS10290 (EFD68_10750) | - | 2075865..2076188 (-) | 324 | WP_001120201.1 | DUF771 domain-containing protein | - |
| EFD68_RS10295 (EFD68_10755) | - | 2076243..2076623 (+) | 381 | WP_000762521.1 | DUF2513 domain-containing protein | - |
| EFD68_RS10300 (EFD68_10760) | - | 2076610..2076807 (-) | 198 | WP_001148856.1 | hypothetical protein | - |
| EFD68_RS10305 (EFD68_10765) | - | 2076823..2077575 (-) | 753 | WP_001148605.1 | phage antirepressor KilAC domain-containing protein | - |
| EFD68_RS10310 (EFD68_10770) | - | 2077626..2077955 (+) | 330 | WP_000128909.1 | hypothetical protein | - |
| EFD68_RS10315 (EFD68_10775) | - | 2077944..2078159 (-) | 216 | WP_001025404.1 | Thoeris anti-defense Tad2 family protein | - |
| EFD68_RS10320 (EFD68_10780) | - | 2078175..2078438 (-) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| EFD68_RS10325 (EFD68_10785) | - | 2078435..2078609 (-) | 175 | Protein_1987 | transcriptional regulator | - |
| EFD68_RS10330 (EFD68_10790) | - | 2078572..2079285 (+) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| EFD68_RS10335 (EFD68_10795) | - | 2079301..2080233 (+) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| EFD68_RS10340 (EFD68_10800) | - | 2080239..2080580 (+) | 342 | WP_000591749.1 | hypothetical protein | - |
| EFD68_RS10345 (EFD68_10805) | - | 2080784..2080966 (+) | 183 | WP_000694772.1 | hypothetical protein | - |
| EFD68_RS10350 (EFD68_10810) | - | 2081066..2082049 (+) | 984 | WP_001558608.1 | glycosyltransferase family 2 protein | - |
| EFD68_RS10355 (EFD68_10815) | - | 2082060..2082302 (+) | 243 | WP_000427213.1 | hypothetical protein | - |
| EFD68_RS10360 (EFD68_10820) | - | 2082365..2083402 (+) | 1038 | WP_000857180.1 | tyrosine-type recombinase/integrase | - |
| EFD68_RS10365 (EFD68_10825) | sph | 2083459..2084283 (+) | 825 | Protein_1995 | sphingomyelin phosphodiesterase | - |
| EFD68_RS10370 (EFD68_10830) | lukG | 2084521..2085537 (-) | 1017 | WP_000595392.1 | bi-component leukocidin LukGH subunit G | - |
| EFD68_RS10375 (EFD68_10835) | lukH | 2085559..2086614 (-) | 1056 | WP_000791411.1 | bi-component leukocidin LukGH subunit H | - |
| EFD68_RS10380 (EFD68_10840) | - | 2087050..2088273 (+) | 1224 | WP_000206625.1 | ArgE/DapE family deacylase | - |
| EFD68_RS10385 (EFD68_10845) | - | 2088776..2090083 (+) | 1308 | WP_001045079.1 | TrkH family potassium uptake protein | - |
| EFD68_RS10390 (EFD68_10855) | groL | 2090623..2092239 (-) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| EFD68_RS10395 (EFD68_10860) | groES | 2092315..2092599 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| EFD68_RS10400 (EFD68_10865) | mroQ | 2092774..2093517 (+) | 744 | WP_156668038.1 | CPBP family intramembrane glutamic endopeptidase MroQ | - |
| EFD68_RS10405 (EFD68_10870) | - | 2093542..2094801 (-) | 1260 | WP_000120297.1 | SdrH family protein | - |
| EFD68_RS10410 (EFD68_10875) | - | 2094998..2095624 (+) | 627 | WP_000522381.1 | nitroreductase family protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=327952 EFD68_RS10250 WP_000934759.1 2070737..2071207(-) (ssbA) [Staphylococcus aureus strain P1D5C1]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=327952 EFD68_RS10250 WP_000934759.1 2070737..2071207(-) (ssbA) [Staphylococcus aureus strain P1D5C1]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |