Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | EGY22_RS12790 | Genome accession | NZ_CP033861 |
| Coordinates | 2811835..2812347 (-) | Length | 170 a.a. |
| NCBI ID | WP_042480119.1 | Uniprot ID | - |
| Organism | Alcaligenes faecalis strain FDAARGOS_491 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2803227..2864445 | 2811835..2812347 | within | 0 |
Gene organization within MGE regions
Location: 2803227..2864445
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EGY22_RS12730 (EGY22_12770) | - | 2803227..2804273 (-) | 1047 | WP_042480102.1 | NADP(H)-dependent aldo-keto reductase | - |
| EGY22_RS12735 (EGY22_12775) | - | 2804442..2804858 (-) | 417 | WP_035267876.1 | YkgJ family cysteine cluster protein | - |
| EGY22_RS12745 (EGY22_12785) | - | 2805555..2806775 (-) | 1221 | WP_042480103.1 | phage integrase central domain-containing protein | - |
| EGY22_RS12750 (EGY22_12790) | - | 2806792..2807016 (-) | 225 | WP_042480106.1 | AlpA family transcriptional regulator | - |
| EGY22_RS18845 | - | 2807449..2807595 (+) | 147 | WP_155274651.1 | hypothetical protein | - |
| EGY22_RS12755 | - | 2807661..2808023 (+) | 363 | WP_123794725.1 | hypothetical protein | - |
| EGY22_RS12760 (EGY22_12795) | - | 2808105..2808737 (-) | 633 | WP_042480108.1 | hypothetical protein | - |
| EGY22_RS12765 (EGY22_12800) | - | 2809351..2809566 (-) | 216 | WP_042480110.1 | hypothetical protein | - |
| EGY22_RS12770 (EGY22_12805) | - | 2809714..2810067 (+) | 354 | WP_042480112.1 | hypothetical protein | - |
| EGY22_RS12775 (EGY22_12810) | - | 2810075..2810974 (-) | 900 | WP_042480115.1 | recombination-associated protein RdgC | - |
| EGY22_RS12780 (EGY22_12815) | - | 2811039..2811725 (+) | 687 | WP_042480116.1 | hypothetical protein | - |
| EGY22_RS12790 (EGY22_12825) | ssb | 2811835..2812347 (-) | 513 | WP_042480119.1 | single-stranded DNA-binding protein | Machinery gene |
| EGY22_RS19030 | - | 2812331..2812540 (-) | 210 | WP_232623232.1 | hypothetical protein | - |
| EGY22_RS19100 | - | 2812595..2812828 (-) | 234 | Protein_2521 | hypothetical protein | - |
| EGY22_RS12800 (EGY22_12835) | - | 2812829..2813464 (-) | 636 | WP_042480121.1 | lambda exonuclease family protein | - |
| EGY22_RS12805 (EGY22_12840) | - | 2813464..2814201 (-) | 738 | WP_080723669.1 | ERF family protein | - |
| EGY22_RS12810 (EGY22_12845) | - | 2814209..2815276 (-) | 1068 | WP_042480124.1 | phage protein | - |
| EGY22_RS12815 (EGY22_12850) | - | 2815459..2815722 (-) | 264 | WP_042480127.1 | hypothetical protein | - |
| EGY22_RS12820 (EGY22_12855) | - | 2815814..2816173 (-) | 360 | WP_042480130.1 | hypothetical protein | - |
| EGY22_RS12825 (EGY22_12865) | - | 2817252..2817662 (+) | 411 | WP_042480134.1 | hypothetical protein | - |
| EGY22_RS12830 (EGY22_12870) | - | 2817655..2817999 (+) | 345 | WP_054513284.1 | hypothetical protein | - |
| EGY22_RS12835 (EGY22_12875) | - | 2818602..2818823 (-) | 222 | WP_042480139.1 | hypothetical protein | - |
| EGY22_RS12845 (EGY22_12885) | - | 2819336..2819659 (+) | 324 | WP_042480141.1 | BrnA antitoxin family protein | - |
| EGY22_RS12850 (EGY22_12890) | - | 2820210..2821025 (-) | 816 | WP_042480144.1 | KilA-N domain-containing protein | - |
| EGY22_RS12855 (EGY22_12900) | - | 2821673..2822665 (-) | 993 | WP_123794729.1 | hypothetical protein | - |
| EGY22_RS12860 (EGY22_12905) | - | 2822821..2823369 (-) | 549 | WP_123794731.1 | hypothetical protein | - |
| EGY22_RS12865 (EGY22_12910) | - | 2823362..2823619 (-) | 258 | WP_123794733.1 | hypothetical protein | - |
| EGY22_RS12870 (EGY22_12920) | - | 2823909..2824295 (-) | 387 | WP_042480158.1 | hypothetical protein | - |
| EGY22_RS12880 (EGY22_12930) | - | 2824619..2824825 (-) | 207 | WP_003800272.1 | hypothetical protein | - |
| EGY22_RS12885 (EGY22_12935) | - | 2824889..2825461 (+) | 573 | WP_042480164.1 | hypothetical protein | - |
| EGY22_RS12890 (EGY22_12940) | - | 2825529..2825873 (+) | 345 | WP_232623231.1 | recombination protein NinB | - |
| EGY22_RS12895 (EGY22_12945) | - | 2825978..2826232 (+) | 255 | WP_232623230.1 | Ref family recombination enhancement nuclease | - |
| EGY22_RS12900 (EGY22_12950) | - | 2826229..2827059 (+) | 831 | WP_052362845.1 | helix-turn-helix domain-containing protein | - |
| EGY22_RS12905 (EGY22_12955) | - | 2827061..2827714 (+) | 654 | WP_042480171.1 | DUF6475 domain-containing protein | - |
| EGY22_RS12910 (EGY22_12960) | - | 2827711..2828046 (+) | 336 | WP_042480173.1 | DUF1064 domain-containing protein | - |
| EGY22_RS12915 (EGY22_12965) | - | 2828271..2828564 (+) | 294 | WP_226791344.1 | hypothetical protein | - |
| EGY22_RS12920 (EGY22_12970) | - | 2828561..2829244 (+) | 684 | WP_042480178.1 | metallophosphoesterase | - |
| EGY22_RS12925 (EGY22_12980) | - | 2829682..2829966 (-) | 285 | WP_069833387.1 | hypothetical protein | - |
| EGY22_RS19075 | - | 2830233..2830286 (+) | 54 | Protein_2546 | hypothetical protein | - |
| EGY22_RS12930 (EGY22_12985) | - | 2830287..2830793 (+) | 507 | WP_052362847.1 | hypothetical protein | - |
| EGY22_RS12935 (EGY22_12990) | - | 2830732..2832006 (+) | 1275 | WP_226791345.1 | terminase large subunit domain-containing protein | - |
| EGY22_RS12940 (EGY22_12995) | - | 2832019..2833455 (+) | 1437 | WP_042480186.1 | DUF4055 domain-containing protein | - |
| EGY22_RS12945 (EGY22_13000) | - | 2833455..2834513 (+) | 1059 | WP_042480188.1 | hypothetical protein | - |
| EGY22_RS12950 (EGY22_13005) | - | 2834652..2835416 (+) | 765 | WP_042480190.1 | DUF6651 domain-containing protein | - |
| EGY22_RS12955 (EGY22_13010) | - | 2835425..2836381 (+) | 957 | WP_042480193.1 | major capsid protein | - |
| EGY22_RS12960 (EGY22_13015) | - | 2836430..2837452 (+) | 1023 | WP_042480195.1 | hypothetical protein | - |
| EGY22_RS12965 (EGY22_13020) | - | 2837449..2837931 (+) | 483 | WP_042480198.1 | DnaT-like ssDNA-binding protein | - |
| EGY22_RS12970 (EGY22_13025) | - | 2837928..2838305 (+) | 378 | WP_052362848.1 | hypothetical protein | - |
| EGY22_RS12975 (EGY22_13030) | - | 2838305..2838754 (+) | 450 | WP_042480200.1 | hypothetical protein | - |
| EGY22_RS12980 (EGY22_13035) | - | 2838751..2839149 (+) | 399 | WP_042480204.1 | phage tail terminator-like protein | - |
| EGY22_RS12985 (EGY22_13040) | - | 2839210..2839662 (+) | 453 | WP_042480207.1 | hypothetical protein | - |
| EGY22_RS12990 (EGY22_13045) | - | 2839793..2840284 (+) | 492 | WP_042482071.1 | Rha family transcriptional regulator | - |
| EGY22_RS12995 (EGY22_13050) | - | 2840321..2840722 (+) | 402 | WP_042480210.1 | phage tail assembly chaperone | - |
| EGY22_RS13000 (EGY22_13060) | - | 2841136..2841639 (-) | 504 | WP_042480214.1 | hypothetical protein | - |
| EGY22_RS13010 (EGY22_13070) | - | 2842324..2845503 (+) | 3180 | WP_042480218.1 | phage tail tape measure protein | - |
| EGY22_RS13015 (EGY22_13075) | - | 2845564..2846454 (-) | 891 | WP_042480220.1 | LysR family transcriptional regulator | - |
| EGY22_RS13020 (EGY22_13080) | - | 2846586..2847194 (+) | 609 | WP_042480222.1 | dimethylmenaquinone methyltransferase | - |
| EGY22_RS13025 (EGY22_13085) | - | 2847272..2848252 (+) | 981 | WP_226791346.1 | tripartite tricarboxylate transporter substrate binding protein | - |
| EGY22_RS13030 (EGY22_13090) | - | 2848422..2848757 (+) | 336 | WP_226791347.1 | hypothetical protein | - |
| EGY22_RS13035 (EGY22_13095) | - | 2848754..2849230 (+) | 477 | WP_042480225.1 | DUF1833 family protein | - |
| EGY22_RS13040 (EGY22_13100) | - | 2849227..2849643 (+) | 417 | WP_042480227.1 | hypothetical protein | - |
| EGY22_RS13045 (EGY22_13105) | - | 2849630..2856922 (+) | 7293 | WP_052362851.1 | hypothetical protein | - |
| EGY22_RS13050 (EGY22_13110) | - | 2856926..2857306 (+) | 381 | WP_226791348.1 | hypothetical protein | - |
| EGY22_RS13055 (EGY22_13115) | - | 2857491..2857808 (+) | 318 | WP_054513283.1 | hypothetical protein | - |
| EGY22_RS13060 (EGY22_13120) | - | 2858328..2859353 (+) | 1026 | WP_123794735.1 | hypothetical protein | - |
| EGY22_RS13065 (EGY22_13125) | - | 2859358..2859903 (+) | 546 | WP_042480238.1 | hypothetical protein | - |
| EGY22_RS13070 (EGY22_13130) | - | 2859996..2860454 (+) | 459 | WP_035272441.1 | hypothetical protein | - |
| EGY22_RS13075 (EGY22_13135) | - | 2860456..2861076 (+) | 621 | WP_080723672.1 | transglycosylase SLT domain-containing protein | - |
| EGY22_RS13080 (EGY22_13140) | - | 2861073..2861321 (+) | 249 | WP_042480240.1 | hypothetical protein | - |
| EGY22_RS13085 (EGY22_13145) | - | 2864146..2864445 (+) | 300 | WP_226791349.1 | lysozyme | - |
Sequence
Protein
Download Length: 170 a.a. Molecular weight: 18980.16 Da Isoelectric Point: 5.9660
>NTDB_id=326489 EGY22_RS12790 WP_042480119.1 2811835..2812347(-) (ssb) [Alcaligenes faecalis strain FDAARGOS_491]
MASVNKWIGIGNLGRDPEVRYSAEGVAICNISIACTETWKDKATGERKEETEWVRVVFYNRLAEIAGEYLRKGRPVYVEG
RLRTRKWTGQDGQERFTTEIIAEQMQMLGGRDGDAQQSNSPPQGQQRNSYADATGHGKQRQAPPPSSGNLADMDDDIPFA
PLLSRNAYCI
MASVNKWIGIGNLGRDPEVRYSAEGVAICNISIACTETWKDKATGERKEETEWVRVVFYNRLAEIAGEYLRKGRPVYVEG
RLRTRKWTGQDGQERFTTEIIAEQMQMLGGRDGDAQQSNSPPQGQQRNSYADATGHGKQRQAPPPSSGNLADMDDDIPFA
PLLSRNAYCI
Nucleotide
Download Length: 513 bp
>NTDB_id=326489 EGY22_RS12790 WP_042480119.1 2811835..2812347(-) (ssb) [Alcaligenes faecalis strain FDAARGOS_491]
ATGGCTTCGGTAAATAAGTGGATCGGCATTGGTAATCTCGGCCGTGATCCGGAGGTTCGATACTCAGCCGAGGGAGTGGC
TATATGCAATATCTCCATCGCTTGCACTGAAACGTGGAAGGACAAAGCTACAGGCGAACGCAAGGAGGAAACCGAGTGGG
TGCGTGTGGTGTTCTACAACCGTCTGGCTGAAATCGCGGGTGAATACTTGCGTAAAGGCCGCCCCGTTTACGTAGAAGGT
CGTCTGCGCACCCGTAAATGGACAGGCCAGGATGGTCAGGAGCGTTTCACCACGGAAATCATTGCCGAGCAAATGCAAAT
GCTAGGCGGTCGCGACGGAGACGCGCAGCAATCAAACTCACCGCCACAGGGTCAGCAGCGCAACAGCTACGCCGACGCCA
CTGGACACGGGAAGCAGCGACAAGCGCCACCGCCCTCGTCCGGCAATCTAGCGGATATGGACGATGACATTCCCTTCGCC
CCTCTGCTCTCGCGCAACGCCTACTGCATCTGA
ATGGCTTCGGTAAATAAGTGGATCGGCATTGGTAATCTCGGCCGTGATCCGGAGGTTCGATACTCAGCCGAGGGAGTGGC
TATATGCAATATCTCCATCGCTTGCACTGAAACGTGGAAGGACAAAGCTACAGGCGAACGCAAGGAGGAAACCGAGTGGG
TGCGTGTGGTGTTCTACAACCGTCTGGCTGAAATCGCGGGTGAATACTTGCGTAAAGGCCGCCCCGTTTACGTAGAAGGT
CGTCTGCGCACCCGTAAATGGACAGGCCAGGATGGTCAGGAGCGTTTCACCACGGAAATCATTGCCGAGCAAATGCAAAT
GCTAGGCGGTCGCGACGGAGACGCGCAGCAATCAAACTCACCGCCACAGGGTCAGCAGCGCAACAGCTACGCCGACGCCA
CTGGACACGGGAAGCAGCGACAAGCGCCACCGCCCTCGTCCGGCAATCTAGCGGATATGGACGATGACATTCCCTTCGCC
CCTCTGCTCTCGCGCAACGCCTACTGCATCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
52.778 |
100 |
0.559 |
| ssb | Glaesserella parasuis strain SC1401 |
46.739 |
100 |
0.506 |
| ssb | Neisseria meningitidis MC58 |
45.977 |
100 |
0.471 |
| ssb | Neisseria gonorrhoeae MS11 |
45.977 |
100 |
0.471 |