Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   EGX81_RS15205 Genome accession   NZ_CP033736
Coordinates   3226396..3226893 (+) Length   165 a.a.
NCBI ID   WP_123822433.1    Uniprot ID   -
Organism   Proteus vulgaris strain FDAARGOS_556     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3187970..3234683 3226396..3226893 within 0


Gene organization within MGE regions


Location: 3187970..3234683
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EGX81_RS14960 (EGX81_15030) potA 3187970..3189085 (-) 1116 WP_123822411.1 spermidine/putrescine ABC transporter ATP-binding protein PotA -
  EGX81_RS14965 (EGX81_15035) - 3189631..3190926 (-) 1296 WP_082239440.1 S8 family peptidase -
  EGX81_RS14970 (EGX81_15040) cbrC 3191087..3191677 (-) 591 WP_036934555.1 PF03691 family colicin E2 tolerance protein CbrC -
  EGX81_RS14980 (EGX81_15050) - 3192129..3192695 (+) 567 WP_072063025.1 Panacea domain-containing protein -
  EGX81_RS14985 (EGX81_15055) - 3192692..3193099 (+) 408 WP_072063026.1 hypothetical protein -
  EGX81_RS14990 (EGX81_15060) - 3193231..3194691 (-) 1461 WP_123822412.1 hypothetical protein -
  EGX81_RS14995 (EGX81_15065) - 3194709..3198047 (-) 3339 WP_123822413.1 DUF1983 domain-containing protein -
  EGX81_RS15000 (EGX81_15070) - 3198048..3198446 (-) 399 WP_123822414.1 DUF6950 family protein -
  EGX81_RS15005 (EGX81_15075) - 3198500..3198775 (-) 276 WP_075674152.1 hypothetical protein -
  EGX81_RS15010 (EGX81_15080) - 3198789..3199370 (-) 582 WP_123822415.1 hypothetical protein -
  EGX81_RS15015 (EGX81_15085) - 3199367..3199966 (-) 600 WP_123822416.1 hypothetical protein -
  EGX81_RS15020 (EGX81_15090) - 3199967..3203278 (-) 3312 WP_192940822.1 phage tail tape measure protein -
  EGX81_RS15030 (EGX81_15100) - 3203537..3203866 (-) 330 WP_252957047.1 phage tail protein -
  EGX81_RS15035 (EGX81_15105) - 3203887..3204360 (-) 474 WP_006533916.1 hypothetical protein -
  EGX81_RS15040 (EGX81_15110) - 3204372..3204773 (-) 402 WP_192940846.1 HK97-gp10 family putative phage morphogenesis protein -
  EGX81_RS15045 (EGX81_15115) - 3204773..3205162 (-) 390 WP_123822420.1 hypothetical protein -
  EGX81_RS15050 (EGX81_15120) - 3205149..3205475 (-) 327 WP_123822421.1 phage head closure protein -
  EGX81_RS15055 (EGX81_15125) - 3205482..3205823 (-) 342 WP_404825202.1 head-tail connector protein -
  EGX81_RS15060 (EGX81_15130) - 3205873..3207096 (-) 1224 WP_109409667.1 phage major capsid protein -
  EGX81_RS15065 (EGX81_15135) - 3207112..3207717 (-) 606 WP_006533922.1 HK97 family phage prohead protease -
  EGX81_RS15070 (EGX81_15140) - 3207707..3208936 (-) 1230 WP_123822422.1 phage portal protein -
  EGX81_RS19740 - 3208926..3209087 (-) 162 WP_006533924.1 hypothetical protein -
  EGX81_RS15075 (EGX81_15145) - 3209084..3210814 (-) 1731 WP_123822423.1 terminase large subunit -
  EGX81_RS15080 (EGX81_15150) - 3210811..3211305 (-) 495 WP_123822424.1 phage terminase small subunit P27 family -
  EGX81_RS15085 (EGX81_15155) - 3211488..3211835 (-) 348 WP_123822425.1 HNH endonuclease -
  EGX81_RS15090 (EGX81_15160) - 3211922..3212341 (-) 420 WP_123822426.1 hypothetical protein -
  EGX81_RS15095 (EGX81_15165) - 3212331..3212642 (-) 312 WP_072065062.1 hypothetical protein -
  EGX81_RS15100 (EGX81_15170) - 3213153..3213614 (-) 462 WP_115370635.1 lysis protein -
  EGX81_RS19745 - 3213617..3213775 (-) 159 WP_181880515.1 hypothetical protein -
  EGX81_RS15105 (EGX81_15175) - 3213757..3214227 (-) 471 WP_115370634.1 lysozyme -
  EGX81_RS15110 (EGX81_15180) - 3214227..3214496 (-) 270 WP_036904926.1 bacteriophage protein -
  EGX81_RS15115 (EGX81_15185) - 3214837..3215085 (-) 249 WP_115370633.1 hypothetical protein -
  EGX81_RS15120 (EGX81_15190) - 3215187..3215858 (-) 672 WP_072065161.1 bacteriophage antitermination protein Q -
  EGX81_RS15125 (EGX81_15195) - 3215886..3216911 (-) 1026 WP_123822427.1 DUF968 domain-containing protein -
  EGX81_RS15130 (EGX81_15200) - 3216908..3217711 (-) 804 WP_123822428.1 KilA-N domain-containing protein -
  EGX81_RS15135 (EGX81_15205) - 3217730..3218113 (-) 384 WP_036904907.1 RusA family crossover junction endodeoxyribonuclease -
  EGX81_RS20075 - 3218176..3218346 (-) 171 WP_404825203.1 Lar family restriction alleviation protein -
  EGX81_RS15140 (EGX81_15210) - 3218343..3218738 (-) 396 WP_123822429.1 hypothetical protein -
  EGX81_RS15145 (EGX81_15215) - 3218735..3219373 (-) 639 WP_099660105.1 phage N-6-adenine-methyltransferase -
  EGX81_RS15150 (EGX81_15220) - 3219370..3220491 (-) 1122 WP_123822430.1 replication protein 15 -
  EGX81_RS15155 (EGX81_15225) - 3220501..3220680 (-) 180 WP_072065167.1 DUF4222 domain-containing protein -
  EGX81_RS15160 (EGX81_15230) - 3220670..3220879 (-) 210 WP_072070914.1 hypothetical protein -
  EGX81_RS15165 (EGX81_15235) - 3220968..3221426 (-) 459 WP_072065169.1 YmfL family putative regulatory protein -
  EGX81_RS15170 (EGX81_15240) - 3221478..3221741 (-) 264 WP_072065170.1 YdaS family helix-turn-helix protein -
  EGX81_RS15175 (EGX81_15245) - 3221866..3222549 (+) 684 WP_072065171.1 helix-turn-helix transcriptional regulator -
  EGX81_RS15180 (EGX81_15250) - 3222532..3223419 (-) 888 WP_072070915.1 BRCT domain-containing protein -
  EGX81_RS15185 (EGX81_15255) - 3223562..3223765 (+) 204 WP_072070916.1 hypothetical protein -
  EGX81_RS15190 (EGX81_15260) - 3223991..3224485 (-) 495 WP_072070917.1 hypothetical protein -
  EGX81_RS15195 (EGX81_15265) rdgC 3224892..3225788 (+) 897 WP_123822431.1 recombination-associated protein RdgC -
  EGX81_RS15200 (EGX81_15270) - 3225870..3226403 (+) 534 WP_123822432.1 HD family hydrolase -
  EGX81_RS15205 (EGX81_15275) ssb 3226396..3226893 (+) 498 WP_123822433.1 single-stranded DNA-binding protein Machinery gene
  EGX81_RS15210 (EGX81_15280) - 3226902..3227357 (+) 456 WP_123822434.1 hypothetical protein -
  EGX81_RS15215 (EGX81_15285) - 3227359..3227994 (+) 636 WP_115349537.1 hypothetical protein -
  EGX81_RS15220 (EGX81_15290) - 3227997..3228218 (+) 222 WP_006533963.1 hypothetical protein -
  EGX81_RS15225 (EGX81_15295) - 3228238..3228678 (+) 441 WP_123822537.1 SAM-dependent methyltransferase -
  EGX81_RS15230 (EGX81_15300) - 3228739..3228984 (+) 246 WP_072065179.1 pyocin activator PrtN family protein -
  EGX81_RS15235 (EGX81_15305) - 3229028..3229315 (-) 288 WP_072065180.1 DinI-like family protein -
  EGX81_RS15240 (EGX81_15310) - 3229369..3230451 (-) 1083 WP_123822435.1 site-specific integrase -
  EGX81_RS15245 (EGX81_15315) dusA 3230548..3231582 (+) 1035 WP_123822436.1 tRNA dihydrouridine(20/20a) synthase DusA -
  EGX81_RS15250 (EGX81_15320) - 3231627..3231941 (-) 315 WP_036934560.1 hypothetical protein -
  EGX81_RS15255 (EGX81_15325) - 3232137..3233120 (-) 984 WP_036934563.1 NADPH:quinone reductase -
  EGX81_RS15260 (EGX81_15330) dnaB 3233274..3234683 (+) 1410 WP_036934568.1 replicative DNA helicase -

Sequence

Protein


Download         Length: 165 a.a.        Molecular weight: 18136.63 Da        Isoelectric Point: 8.0068

>NTDB_id=325218 EGX81_RS15205 WP_123822433.1 3226396..3226893(+) (ssb) [Proteus vulgaris strain FDAARGOS_556]
MANGSVNKVILIGNLGRDPEIRYLPSGGAVANLAVATSEKWRDKQTGDNREKTEWHRVVLFGKLADIASGYLCKGSQVYI
EGQLQTREWDDNGVKRYTTEIVVKVGGSMQMLGGASKSVGSQPAQQNQPPAQPQVKNNQPLMDFEDDIPFAPIGLMYPRH
LINVI

Nucleotide


Download         Length: 498 bp        

>NTDB_id=325218 EGX81_RS15205 WP_123822433.1 3226396..3226893(+) (ssb) [Proteus vulgaris strain FDAARGOS_556]
ATGGCTAACGGATCAGTAAACAAAGTAATTCTTATCGGCAATTTAGGTCGTGATCCTGAAATTCGCTACCTGCCTTCTGG
TGGTGCTGTTGCCAATTTAGCTGTGGCCACATCAGAAAAGTGGCGAGATAAACAAACGGGTGACAACCGAGAAAAGACAG
AATGGCACCGTGTCGTTCTGTTTGGAAAACTCGCTGATATCGCCAGTGGCTATTTGTGCAAAGGCTCTCAAGTTTATATC
GAGGGGCAATTACAAACCCGCGAATGGGATGATAACGGTGTTAAACGCTATACAACAGAAATTGTTGTAAAGGTTGGTGG
TTCGATGCAAATGCTAGGTGGTGCTAGTAAATCAGTAGGTTCACAACCGGCACAGCAAAATCAGCCACCAGCTCAACCTC
AAGTCAAAAACAATCAGCCACTAATGGATTTTGAAGATGATATCCCTTTCGCACCGATTGGGCTTATGTATCCACGCCAT
TTAATTAATGTGATTTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(6-111)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

57.062

100

0.612
  ssb Glaesserella parasuis strain SC1401

46.111

100

0.503
  ssb Neisseria meningitidis MC58

42.373

100

0.455
  ssb Neisseria gonorrhoeae MS11

42.373

100

0.455

Multiple sequence alignment