Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   EGX68_RS03380 Genome accession   NZ_CP033735
Coordinates   610661..611101 (+) Length   146 a.a.
NCBI ID   WP_103211317.1    Uniprot ID   -
Organism   Staphylococcus cohnii strain FDAARGOS_538     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 601974..648092 610661..611101 within 0


Gene organization within MGE regions


Location: 601974..648092
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EGX68_RS03310 (EGX68_03300) sufB 601974..603371 (+) 1398 WP_019469760.1 Fe-S cluster assembly protein SufB -
  EGX68_RS03315 (EGX68_03305) - 603440..604498 (-) 1059 WP_019469759.1 tyrosine-type recombinase/integrase -
  EGX68_RS03320 (EGX68_03310) - 604560..605108 (-) 549 WP_174890065.1 hypothetical protein -
  EGX68_RS03325 (EGX68_03315) - 605237..605728 (-) 492 WP_103211326.1 PH domain-containing protein -
  EGX68_RS03330 (EGX68_03320) - 605744..606208 (-) 465 WP_103211325.1 ImmA/IrrE family metallo-endopeptidase -
  EGX68_RS03335 (EGX68_03325) - 606220..606552 (-) 333 WP_103211324.1 helix-turn-helix transcriptional regulator -
  EGX68_RS03340 (EGX68_03330) - 606746..606997 (+) 252 WP_069795256.1 helix-turn-helix transcriptional regulator -
  EGX68_RS03345 (EGX68_03335) - 606998..607810 (+) 813 WP_103211323.1 DUF3102 domain-containing protein -
  EGX68_RS03350 (EGX68_03340) - 607814..608662 (+) 849 WP_103211322.1 ParB N-terminal domain-containing protein -
  EGX68_RS03355 (EGX68_03345) - 608820..609032 (+) 213 WP_103211321.1 hypothetical protein -
  EGX68_RS03360 (EGX68_03350) - 609029..609238 (-) 210 WP_038678654.1 hypothetical protein -
  EGX68_RS03365 (EGX68_03355) - 609315..609521 (+) 207 WP_103211320.1 hypothetical protein -
  EGX68_RS03370 (EGX68_03360) - 609764..610018 (+) 255 WP_103211319.1 hypothetical protein -
  EGX68_RS03375 (EGX68_03365) - 610011..610658 (+) 648 WP_103211318.1 ERF family protein -
  EGX68_RS03380 (EGX68_03370) ssbA 610661..611101 (+) 441 WP_103211317.1 single-stranded DNA-binding protein Machinery gene
  EGX68_RS03385 (EGX68_03375) - 611130..611801 (+) 672 WP_103211316.1 putative HNHc nuclease -
  EGX68_RS03390 (EGX68_03380) - 611798..612550 (+) 753 WP_103211315.1 DnaD domain protein -
  EGX68_RS03395 (EGX68_03385) - 612556..612924 (+) 369 WP_103211314.1 hypothetical protein -
  EGX68_RS03400 (EGX68_03390) - 612914..614149 (+) 1236 WP_103211313.1 DnaB helicase C-terminal domain-containing protein -
  EGX68_RS03410 (EGX68_03400) - 614343..614579 (+) 237 WP_103211311.1 DUF3269 family protein -
  EGX68_RS03415 (EGX68_03405) - 614590..615003 (+) 414 WP_103211310.1 RusA family crossover junction endodeoxyribonuclease -
  EGX68_RS03420 (EGX68_03410) - 614996..615193 (+) 198 WP_103211309.1 hypothetical protein -
  EGX68_RS03425 (EGX68_03415) - 615195..615596 (+) 402 WP_103211308.1 hypothetical protein -
  EGX68_RS03430 (EGX68_03420) - 615608..615826 (+) 219 WP_103211307.1 hypothetical protein -
  EGX68_RS03435 (EGX68_03425) - 615827..616309 (+) 483 WP_231912215.1 DUF3310 domain-containing protein -
  EGX68_RS03440 (EGX68_03430) - 616310..616615 (+) 306 WP_069973593.1 DUF1140 family protein -
  EGX68_RS03445 (EGX68_03440) - 616815..617090 (+) 276 WP_103211305.1 hypothetical protein -
  EGX68_RS03450 (EGX68_03445) - 617091..617339 (+) 249 WP_040030406.1 hypothetical protein -
  EGX68_RS03455 (EGX68_03450) dut 617336..617758 (+) 423 WP_103211304.1 dUTP diphosphatase -
  EGX68_RS03460 (EGX68_03455) - 617806..618036 (+) 231 WP_103211303.1 DUF1381 domain-containing protein -
  EGX68_RS03465 (EGX68_03460) - 618038..618271 (+) 234 WP_103211302.1 hypothetical protein -
  EGX68_RS03470 (EGX68_03465) - 618273..618407 (+) 135 WP_103211301.1 transcriptional regulator -
  EGX68_RS03475 (EGX68_03470) - 618407..618634 (+) 228 WP_103211300.1 DUF1514 family protein -
  EGX68_RS03480 (EGX68_03475) - 618648..619043 (+) 396 WP_053464119.1 hypothetical protein -
  EGX68_RS03485 (EGX68_03480) - 619322..619636 (+) 315 WP_103211299.1 HNH endonuclease -
  EGX68_RS03490 (EGX68_03485) - 619821..620183 (+) 363 WP_103211298.1 hypothetical protein -
  EGX68_RS03495 (EGX68_03490) - 620180..621850 (+) 1671 WP_103211297.1 terminase TerL endonuclease subunit -
  EGX68_RS03500 (EGX68_03495) - 621866..623044 (+) 1179 WP_103211296.1 phage portal protein -
  EGX68_RS03505 (EGX68_03500) - 623007..623714 (+) 708 WP_103211295.1 head maturation protease, ClpP-related -
  EGX68_RS03510 (EGX68_03505) - 623726..624919 (+) 1194 WP_103211294.1 phage major capsid protein -
  EGX68_RS03515 (EGX68_03510) - 624934..625221 (+) 288 WP_103211293.1 phage head-tail connector protein -
  EGX68_RS03520 (EGX68_03515) - 625205..625573 (+) 369 WP_103211292.1 hypothetical protein -
  EGX68_RS03525 (EGX68_03520) - 625563..625952 (+) 390 WP_103211291.1 hypothetical protein -
  EGX68_RS03530 (EGX68_03525) - 625973..626380 (+) 408 WP_126116909.1 hypothetical protein -
  EGX68_RS03535 (EGX68_03530) - 626380..626976 (+) 597 WP_103211289.1 major tail protein -
  EGX68_RS03540 (EGX68_03535) - 626995..627192 (+) 198 WP_103211288.1 hypothetical protein -
  EGX68_RS03545 (EGX68_03540) gpG 627262..627621 (+) 360 WP_103211287.1 phage tail assembly chaperone G -
  EGX68_RS03550 (EGX68_03545) gpG 627691..628158 (+) 468 WP_147096598.1 phage tail assembly chaperone G -
  EGX68_RS03555 (EGX68_03550) - 628300..633405 (+) 5106 WP_103211285.1 phage tail tape measure protein -
  EGX68_RS03560 (EGX68_03555) - 633427..634260 (+) 834 WP_231912214.1 phage tail domain-containing protein -
  EGX68_RS03565 (EGX68_03560) - 634273..636189 (+) 1917 WP_103211284.1 hypothetical protein -
  EGX68_RS03570 (EGX68_03565) - 636251..638707 (+) 2457 WP_103211283.1 phage tail spike protein -
  EGX68_RS13490 - 638694..638846 (+) 153 WP_172459302.1 hypothetical protein -
  EGX68_RS03575 (EGX68_03570) - 638884..639306 (+) 423 WP_103211282.1 hypothetical protein -
  EGX68_RS03580 (EGX68_03575) - 639293..639691 (+) 399 WP_103211281.1 hypothetical protein -
  EGX68_RS03585 (EGX68_03580) - 639797..640279 (+) 483 WP_103211280.1 phage holin -
  EGX68_RS03590 (EGX68_03585) - 640266..641744 (+) 1479 WP_103211279.1 SH3 domain-containing protein -
  EGX68_RS03595 (EGX68_03590) - 641812..643215 (+) 1404 WP_103211278.1 hypothetical protein -
  EGX68_RS03600 (EGX68_03595) - 644078..645097 (+) 1020 WP_019469692.1 hemolysin family protein -
  EGX68_RS03605 (EGX68_03600) - 645150..646217 (+) 1068 WP_040030172.1 nitronate monooxygenase family protein -
  EGX68_RS03610 (EGX68_03605) - 646407..647255 (+) 849 WP_103211277.1 DUF72 domain-containing protein -
  EGX68_RS03615 (EGX68_03610) - 647268..648092 (+) 825 WP_019469689.1 sulfite exporter TauE/SafE family protein -

Sequence


Protein


Download         Length: 146 a.a.        Molecular weight: 16426.21 Da        Isoelectric Point: 5.9067

>NTDB_id=325176 EGX68_RS03380 WP_103211317.1 610661..611101(+) (ssbA) [Staphylococcus cohnii strain FDAARGOS_538]
MINRVILVGRLTKDPEFRTTPSGVNVATFTLAVNRTFTNAQGEREADFINCVVFRKQAENVNKYLFKGHLAGVDGRIQSR
SYENQEGRRIFVTEVVTDSVQFLETKNNEQKQNVSKGQQTGTNNQQLSNDNPFANGVDVDPDDLPF

Nucleotide


Download         Length: 441 bp        

>NTDB_id=325176 EGX68_RS03380 WP_103211317.1 610661..611101(+) (ssbA) [Staphylococcus cohnii strain FDAARGOS_538]
ATGATAAACAGAGTAATTTTAGTCGGTCGTTTAACTAAAGACCCAGAATTCAGAACAACACCATCTGGCGTGAATGTCGC
AACTTTCACGTTAGCAGTCAATCGTACATTCACAAATGCGCAAGGTGAACGTGAAGCAGATTTTATAAACTGTGTTGTAT
TTAGAAAGCAAGCAGAGAATGTAAACAAATACTTATTTAAAGGCCATTTAGCTGGTGTTGATGGCCGTATCCAATCACGT
AGCTATGAAAACCAAGAGGGGCGTCGTATTTTCGTTACCGAAGTTGTTACGGACAGCGTACAGTTCTTAGAGACAAAGAA
TAACGAACAGAAACAGAATGTTTCAAAAGGACAACAGACTGGCACAAATAACCAACAGTTAAGCAATGACAATCCATTTG
CAAACGGTGTAGATGTGGACCCGGACGATTTGCCATTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.233

100

0.651

  ssb Latilactobacillus sakei subsp. sakei 23K

52.353

100

0.61

  ssbB Bacillus subtilis subsp. subtilis str. 168

56.637

77.397

0.438

  ssbA Streptococcus mutans UA159

39.041

100

0.39


Multiple sequence alignment