Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | PmCQ6_RS00250 | Genome accession | NZ_CP033600 |
| Coordinates | 40342..40806 (-) | Length | 154 a.a. |
| NCBI ID | WP_016570065.1 | Uniprot ID | - |
| Organism | Pasteurella multocida strain CQ6 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 35137..84693 | 40342..40806 | within | 0 |
Gene organization within MGE regions
Location: 35137..84693
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PmCQ6_RS00210 (PmCQ6_000210) | - | 35137..36174 (-) | 1038 | WP_016533424.1 | tyrosine-type recombinase/integrase | - |
| PmCQ6_RS11225 | - | 36183..36569 (-) | 387 | WP_016533425.1 | hypothetical protein | - |
| PmCQ6_RS11230 | - | 36685..37170 (-) | 486 | WP_016533426.1 | hypothetical protein | - |
| PmCQ6_RS00220 (PmCQ6_000220) | - | 37256..37555 (-) | 300 | WP_016533427.1 | hypothetical protein | - |
| PmCQ6_RS00225 (PmCQ6_000225) | - | 37565..38098 (-) | 534 | WP_016570062.1 | DUF551 domain-containing protein | - |
| PmCQ6_RS00230 (PmCQ6_000230) | - | 38233..38832 (-) | 600 | WP_014391447.1 | hypothetical protein | - |
| PmCQ6_RS00235 (PmCQ6_000235) | - | 38883..39671 (-) | 789 | WP_014391448.1 | DUF2303 family protein | - |
| PmCQ6_RS00240 (PmCQ6_000240) | - | 39743..40096 (-) | 354 | WP_016570064.1 | hypothetical protein | - |
| PmCQ6_RS00245 (PmCQ6_000245) | - | 40139..40330 (-) | 192 | WP_016533530.1 | hypothetical protein | - |
| PmCQ6_RS00250 (PmCQ6_000250) | ssb | 40342..40806 (-) | 465 | WP_016570065.1 | single-stranded DNA-binding protein | Machinery gene |
| PmCQ6_RS00255 (PmCQ6_000255) | - | 40810..41421 (-) | 612 | WP_064775601.1 | YqaJ viral recombinase family protein | - |
| PmCQ6_RS00260 (PmCQ6_000260) | bet | 41414..42265 (-) | 852 | WP_016533454.1 | phage recombination protein Bet | - |
| PmCQ6_RS00265 (PmCQ6_000265) | - | 42269..43255 (-) | 987 | WP_016570067.1 | hypothetical protein | - |
| PmCQ6_RS11150 | - | 43258..43419 (-) | 162 | WP_014390707.1 | hypothetical protein | - |
| PmCQ6_RS00270 (PmCQ6_000270) | - | 43433..43669 (-) | 237 | WP_016570068.1 | hypothetical protein | - |
| PmCQ6_RS00275 (PmCQ6_000275) | - | 43656..43940 (-) | 285 | WP_064775602.1 | hypothetical protein | - |
| PmCQ6_RS00280 (PmCQ6_000280) | - | 44088..44318 (+) | 231 | WP_223251317.1 | hypothetical protein | - |
| PmCQ6_RS11235 | - | 44380..45066 (-) | 687 | WP_231730760.1 | Bro-N domain-containing protein | - |
| PmCQ6_RS11385 | - | 45402..45527 (+) | 126 | WP_014391103.1 | hypothetical protein | - |
| PmCQ6_RS00290 (PmCQ6_000290) | - | 45528..46061 (-) | 534 | WP_014391102.1 | hypothetical protein | - |
| PmCQ6_RS00295 (PmCQ6_000295) | - | 46149..46412 (-) | 264 | WP_102827045.1 | hypothetical protein | - |
| PmCQ6_RS00300 (PmCQ6_000300) | - | 46509..48038 (-) | 1530 | WP_228767747.1 | SIR2 family protein | - |
| PmCQ6_RS00305 (PmCQ6_000305) | - | 48447..48737 (-) | 291 | WP_102827047.1 | hypothetical protein | - |
| PmCQ6_RS11155 | - | 49044..49196 (-) | 153 | WP_197417893.1 | hypothetical protein | - |
| PmCQ6_RS00310 (PmCQ6_000310) | - | 49459..49773 (+) | 315 | WP_016570073.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| PmCQ6_RS00315 (PmCQ6_000315) | - | 49770..50060 (+) | 291 | WP_016570074.1 | addiction module antidote protein | - |
| PmCQ6_RS00320 (PmCQ6_000320) | - | 50085..50588 (-) | 504 | WP_016570075.1 | hypothetical protein | - |
| PmCQ6_RS00325 (PmCQ6_000325) | - | 50560..50955 (-) | 396 | WP_016570076.1 | hypothetical protein | - |
| PmCQ6_RS00330 (PmCQ6_000330) | - | 51023..51679 (-) | 657 | WP_016570077.1 | XRE family transcriptional regulator | - |
| PmCQ6_RS00335 (PmCQ6_000335) | - | 51810..52016 (+) | 207 | WP_016570078.1 | helix-turn-helix transcriptional regulator | - |
| PmCQ6_RS00340 (PmCQ6_000340) | - | 52065..52517 (+) | 453 | WP_016570079.1 | phage regulatory CII family protein | - |
| PmCQ6_RS00345 (PmCQ6_000345) | - | 52575..52835 (+) | 261 | WP_014391467.1 | Rha family transcriptional regulator | - |
| PmCQ6_RS00350 (PmCQ6_000350) | - | 52920..53738 (+) | 819 | WP_015691057.1 | hypothetical protein | - |
| PmCQ6_RS00355 (PmCQ6_000355) | - | 53735..55099 (+) | 1365 | WP_015691058.1 | replicative DNA helicase | - |
| PmCQ6_RS00360 (PmCQ6_000360) | - | 55096..55464 (+) | 369 | WP_015691059.1 | MT-A70 family methyltransferase | - |
| PmCQ6_RS00365 (PmCQ6_000365) | - | 55474..55824 (+) | 351 | WP_015691060.1 | hypothetical protein | - |
| PmCQ6_RS00370 (PmCQ6_000370) | - | 55846..56352 (+) | 507 | WP_015691061.1 | DUF1367 family protein | - |
| PmCQ6_RS00375 (PmCQ6_000375) | - | 56503..57105 (+) | 603 | WP_016570080.1 | recombination protein NinG | - |
| PmCQ6_RS00380 (PmCQ6_000380) | - | 57105..57470 (+) | 366 | WP_016533470.1 | antiterminator Q family protein | - |
| PmCQ6_RS00385 (PmCQ6_000390) | - | 58272..58529 (+) | 258 | WP_099821837.1 | holin | - |
| PmCQ6_RS00390 (PmCQ6_000395) | - | 58526..59056 (+) | 531 | WP_069915984.1 | lysozyme | - |
| PmCQ6_RS00395 (PmCQ6_000400) | - | 59029..59352 (+) | 324 | WP_079157976.1 | DUF2570 family protein | - |
| PmCQ6_RS11240 | - | 59574..59846 (-) | 273 | WP_231730761.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| PmCQ6_RS00405 (PmCQ6_000415) | - | 60012..60212 (-) | 201 | WP_156707166.1 | type II toxin-antitoxin system HicA family toxin | - |
| PmCQ6_RS00410 (PmCQ6_000420) | - | 60295..60792 (+) | 498 | WP_014390737.1 | terminase | - |
| PmCQ6_RS00415 (PmCQ6_000425) | - | 60776..62011 (+) | 1236 | WP_156707167.1 | PBSX family phage terminase large subunit | - |
| PmCQ6_RS00420 (PmCQ6_000430) | - | 62021..63424 (+) | 1404 | WP_102827081.1 | DUF4055 domain-containing protein | - |
| PmCQ6_RS00425 (PmCQ6_000435) | - | 63414..65015 (+) | 1602 | WP_064775738.1 | minor capsid protein | - |
| PmCQ6_RS00430 (PmCQ6_000440) | - | 65018..65236 (+) | 219 | WP_015691070.1 | hypothetical protein | - |
| PmCQ6_RS00435 (PmCQ6_000445) | - | 65211..65645 (+) | 435 | WP_015691071.1 | HD domain-containing protein | - |
| PmCQ6_RS11160 | - | 65685..65852 (+) | 168 | WP_015691072.1 | hypothetical protein | - |
| PmCQ6_RS00440 (PmCQ6_000450) | - | 65981..66751 (+) | 771 | WP_015691073.1 | hypothetical protein | - |
| PmCQ6_RS00445 (PmCQ6_000455) | - | 66769..67926 (+) | 1158 | WP_015691074.1 | P22 phage major capsid protein family protein | - |
| PmCQ6_RS00450 (PmCQ6_000460) | - | 67983..68219 (+) | 237 | WP_015691075.1 | HeH/LEM domain-containing protein | - |
| PmCQ6_RS00455 (PmCQ6_000465) | - | 68236..68703 (+) | 468 | WP_015691076.1 | DnaT-like ssDNA-binding protein | - |
| PmCQ6_RS00460 (PmCQ6_000470) | - | 68705..69079 (+) | 375 | WP_015691077.1 | hypothetical protein | - |
| PmCQ6_RS00465 (PmCQ6_000475) | - | 69081..69482 (+) | 402 | WP_102827082.1 | HK97 gp10 family phage protein | - |
| PmCQ6_RS00470 (PmCQ6_000480) | - | 69482..69877 (+) | 396 | WP_064964910.1 | phage tail terminator-like protein | - |
| PmCQ6_RS00475 (PmCQ6_000485) | - | 69890..70906 (+) | 1017 | WP_064964909.1 | phage tail tube protein | - |
| PmCQ6_RS00480 (PmCQ6_000490) | - | 70980..71384 (+) | 405 | WP_005756587.1 | hypothetical protein | - |
| PmCQ6_RS00485 (PmCQ6_000495) | - | 71393..71722 (+) | 330 | WP_015691081.1 | hypothetical protein | - |
| PmCQ6_RS00490 (PmCQ6_000500) | - | 71730..72056 (+) | 327 | WP_015691082.1 | phage tail protein | - |
| PmCQ6_RS00495 (PmCQ6_000505) | - | 72074..75322 (+) | 3249 | WP_064964908.1 | tape measure protein | - |
| PmCQ6_RS00500 (PmCQ6_000510) | - | 75319..76023 (+) | 705 | WP_102827080.1 | phage minor tail protein L | - |
| PmCQ6_RS00505 (PmCQ6_000515) | - | 76026..76760 (+) | 735 | WP_102827079.1 | C40 family peptidase | - |
| PmCQ6_RS00510 (PmCQ6_000520) | - | 76703..77326 (+) | 624 | WP_102827078.1 | tail assembly protein | - |
| PmCQ6_RS11245 | - | 78359..78837 (+) | 479 | Protein_102 | phage tail protein | - |
| PmCQ6_RS11250 | - | 78917..79186 (+) | 270 | WP_231730762.1 | hypothetical protein | - |
| PmCQ6_RS11255 | - | 79216..79470 (+) | 255 | WP_231730763.1 | hypothetical protein | - |
| PmCQ6_RS11260 | - | 79633..79974 (+) | 342 | WP_231730764.1 | hypothetical protein | - |
| PmCQ6_RS11265 | - | 80959..83220 (+) | 2262 | WP_231730765.1 | DUF1983 domain-containing protein | - |
| PmCQ6_RS00520 (PmCQ6_000530) | - | 83233..83559 (+) | 327 | WP_156707168.1 | hypothetical protein | - |
| PmCQ6_RS11270 | - | 83693..83836 (-) | 144 | WP_231730766.1 | transposase | - |
| PmCQ6_RS11390 | - | 83910..84044 (-) | 135 | WP_269452509.1 | hypothetical protein | - |
| PmCQ6_RS11275 | - | 84223..84693 (-) | 471 | WP_231730767.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 154 a.a. Molecular weight: 17207.00 Da Isoelectric Point: 6.9818
>NTDB_id=324225 PmCQ6_RS00250 WP_016570065.1 40342..40806(-) (ssb) [Pasteurella multocida strain CQ6]
MAGVNKVIIVGNLGNDPDVRTMPNGDAVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQAQANAQANAQAPQNNAYANAKAGKPVQQADSFEDDSIPF
MAGVNKVIIVGNLGNDPDVRTMPNGDAVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQAQANAQANAQAPQNNAYANAKAGKPVQQADSFEDDSIPF
Nucleotide
Download Length: 465 bp
>NTDB_id=324225 PmCQ6_RS00250 WP_016570065.1 40342..40806(-) (ssb) [Pasteurella multocida strain CQ6]
ATGGCTGGGGTAAATAAAGTAATTATCGTCGGGAATTTGGGAAACGATCCTGATGTCCGCACAATGCCAAATGGCGACGC
AGTGGCAAAAATTAGTGTGGCCACGAGCGAAAGTTGGATCGACAAAAACACGAACGAGCGAAAAACGCAGACAGAATGGC
ACTCTATCGTGTTTTATCGCCGCCAAGCAGAAATTTGCGGGCAGTATCTCAAAAAAGGATCGAAAGTGTATGTGGAAGGG
CGTTTAAGAACTCGTAAATGGCAAGACCAAAACGGGCAAGACCGCTACACCACTGAAATCCAAGGCGACGTATTGCAGAT
GTTAGACAGTCGCCAAGATTCACAAGCACAAGCTAACGCACAAGCTAACGCACAAGCACCGCAAAACAATGCTTATGCCA
ATGCGAAAGCTGGAAAGCCAGTGCAACAGGCTGATAGTTTTGAAGATGATAGCATACCTTTTTAA
ATGGCTGGGGTAAATAAAGTAATTATCGTCGGGAATTTGGGAAACGATCCTGATGTCCGCACAATGCCAAATGGCGACGC
AGTGGCAAAAATTAGTGTGGCCACGAGCGAAAGTTGGATCGACAAAAACACGAACGAGCGAAAAACGCAGACAGAATGGC
ACTCTATCGTGTTTTATCGCCGCCAAGCAGAAATTTGCGGGCAGTATCTCAAAAAAGGATCGAAAGTGTATGTGGAAGGG
CGTTTAAGAACTCGTAAATGGCAAGACCAAAACGGGCAAGACCGCTACACCACTGAAATCCAAGGCGACGTATTGCAGAT
GTTAGACAGTCGCCAAGATTCACAAGCACAAGCTAACGCACAAGCTAACGCACAAGCACCGCAAAACAATGCTTATGCCA
ATGCGAAAGCTGGAAAGCCAGTGCAACAGGCTGATAGTTTTGAAGATGATAGCATACCTTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
62.983 |
100 |
0.74 |
| ssb | Vibrio cholerae strain A1552 |
48.276 |
100 |
0.545 |
| ssb | Neisseria meningitidis MC58 |
42.775 |
100 |
0.481 |
| ssb | Neisseria gonorrhoeae MS11 |
42.775 |
100 |
0.481 |