Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   FGE23_RS00305 Genome accession   NZ_CP040672
Coordinates   57949..58089 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain X030     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 52949..63089
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FGE23_RS00280 - 53276..53659 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  FGE23_RS00285 comA 53681..54325 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  FGE23_RS00290 comP 54406..56712 (-) 2307 WP_146275405.1 sensor histidine kinase Regulator
  FGE23_RS00295 comX 56731..56907 (-) 177 WP_044052947.1 competence pheromone ComX -
  FGE23_RS00300 comQ 56922..57797 (-) 876 WP_146277410.1 polyprenyl synthetase family protein Regulator
  FGE23_RS00305 degQ 57949..58089 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  FGE23_RS00315 - 58554..58895 (+) 342 WP_014305721.1 hypothetical protein -
  FGE23_RS00320 - 58902..60122 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  FGE23_RS00325 - 60252..61718 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  FGE23_RS00330 - 61736..62287 (-) 552 WP_146275407.1 cysteine hydrolase family protein -
  FGE23_RS00335 - 62384..62782 (-) 399 WP_003152031.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=323004 FGE23_RS00305 WP_003152043.1 57949..58089(-) (degQ) [Bacillus amyloliquefaciens strain X030]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=323004 FGE23_RS00305 WP_003152043.1 57949..58089(-) (degQ) [Bacillus amyloliquefaciens strain X030]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891


Multiple sequence alignment