Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | FGE23_RS00305 | Genome accession | NZ_CP040672 |
| Coordinates | 57949..58089 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus amyloliquefaciens strain X030 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 52949..63089
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FGE23_RS00280 | - | 53276..53659 (-) | 384 | WP_007613430.1 | hotdog fold thioesterase | - |
| FGE23_RS00285 | comA | 53681..54325 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| FGE23_RS00290 | comP | 54406..56712 (-) | 2307 | WP_146275405.1 | sensor histidine kinase | Regulator |
| FGE23_RS00295 | comX | 56731..56907 (-) | 177 | WP_044052947.1 | competence pheromone ComX | - |
| FGE23_RS00300 | comQ | 56922..57797 (-) | 876 | WP_146277410.1 | polyprenyl synthetase family protein | Regulator |
| FGE23_RS00305 | degQ | 57949..58089 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| FGE23_RS00315 | - | 58554..58895 (+) | 342 | WP_014305721.1 | hypothetical protein | - |
| FGE23_RS00320 | - | 58902..60122 (-) | 1221 | WP_003152038.1 | EAL and HDOD domain-containing protein | - |
| FGE23_RS00325 | - | 60252..61718 (-) | 1467 | WP_014305722.1 | nicotinate phosphoribosyltransferase | - |
| FGE23_RS00330 | - | 61736..62287 (-) | 552 | WP_146275407.1 | cysteine hydrolase family protein | - |
| FGE23_RS00335 | - | 62384..62782 (-) | 399 | WP_003152031.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=323004 FGE23_RS00305 WP_003152043.1 57949..58089(-) (degQ) [Bacillus amyloliquefaciens strain X030]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=323004 FGE23_RS00305 WP_003152043.1 57949..58089(-) (degQ) [Bacillus amyloliquefaciens strain X030]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |