Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | At1D1108_RS17880 | Genome accession | NZ_CP032922 |
| Coordinates | 896490..896981 (+) | Length | 163 a.a. |
| NCBI ID | WP_121557264.1 | Uniprot ID | - |
| Organism | Agrobacterium tumefaciens strain 1D1108 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 855894..901675 | 896490..896981 | within | 0 |
Gene organization within MGE regions
Location: 855894..901675
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| At1D1108_RS17635 (At1D1108_34260) | - | 855894..856601 (-) | 708 | WP_121557220.1 | N-acetylmuramoyl-L-alanine amidase | - |
| At1D1108_RS17640 (At1D1108_34270) | - | 856723..857730 (-) | 1008 | WP_121557221.1 | FkbM family methyltransferase | - |
| At1D1108_RS17645 (At1D1108_34280) | - | 857837..858376 (-) | 540 | WP_121557222.1 | hypothetical protein | - |
| At1D1108_RS17650 (At1D1108_34290) | - | 858373..859434 (-) | 1062 | WP_121557223.1 | hypothetical protein | - |
| At1D1108_RS17655 (At1D1108_34300) | - | 859450..860154 (-) | 705 | WP_162995265.1 | putative phage tail protein | - |
| At1D1108_RS17660 (At1D1108_34310) | - | 860144..861229 (-) | 1086 | WP_121557225.1 | baseplate J/gp47 family protein | - |
| At1D1108_RS17665 (At1D1108_34320) | - | 861201..861737 (-) | 537 | WP_121557226.1 | phage GP46 family protein | - |
| At1D1108_RS17670 (At1D1108_34330) | - | 861748..862236 (-) | 489 | WP_121557227.1 | phage baseplate assembly protein domain-containing protein | - |
| At1D1108_RS17675 (At1D1108_34340) | - | 862233..863297 (-) | 1065 | WP_121557228.1 | phage baseplate assembly protein | - |
| At1D1108_RS17680 (At1D1108_34350) | - | 863297..863920 (-) | 624 | WP_121557229.1 | hypothetical protein | - |
| At1D1108_RS17685 (At1D1108_34360) | - | 863920..864378 (-) | 459 | WP_121557230.1 | DNA circularization N-terminal domain-containing protein | - |
| At1D1108_RS17690 (At1D1108_34370) | - | 864377..864973 (+) | 597 | WP_162995266.1 | hypothetical protein | - |
| At1D1108_RS17695 (At1D1108_34380) | - | 864983..866944 (-) | 1962 | WP_121557232.1 | phage tail tape measure protein | - |
| At1D1108_RS17700 (At1D1108_34390) | - | 866954..867496 (-) | 543 | WP_153314865.1 | hypothetical protein | - |
| At1D1108_RS17705 (At1D1108_34400) | - | 867621..867941 (-) | 321 | WP_121557234.1 | hypothetical protein | - |
| At1D1108_RS17710 (At1D1108_34410) | - | 867951..868322 (-) | 372 | WP_121557235.1 | phage tail tube protein | - |
| At1D1108_RS17715 (At1D1108_34420) | - | 868372..869850 (-) | 1479 | WP_121557236.1 | hypothetical protein | - |
| At1D1108_RS17720 (At1D1108_34430) | - | 869855..870037 (-) | 183 | WP_121557237.1 | hypothetical protein | - |
| At1D1108_RS17725 (At1D1108_34440) | - | 870050..870781 (-) | 732 | WP_121557238.1 | hypothetical protein | - |
| At1D1108_RS17730 (At1D1108_34450) | - | 870768..871169 (-) | 402 | WP_121557239.1 | hypothetical protein | - |
| At1D1108_RS17735 (At1D1108_34460) | - | 871174..871500 (-) | 327 | WP_121557240.1 | hypothetical protein | - |
| At1D1108_RS17740 (At1D1108_34470) | - | 871502..872557 (-) | 1056 | WP_121557241.1 | major capsid protein | - |
| At1D1108_RS17745 (At1D1108_34480) | - | 872582..872923 (-) | 342 | WP_121557242.1 | hypothetical protein | - |
| At1D1108_RS17750 (At1D1108_34490) | - | 872925..873974 (-) | 1050 | WP_121557243.1 | head maturation protease, ClpP-related | - |
| At1D1108_RS17755 (At1D1108_34500) | - | 874016..874285 (-) | 270 | WP_121557244.1 | hypothetical protein | - |
| At1D1108_RS17760 (At1D1108_34510) | - | 874285..875898 (-) | 1614 | WP_121557592.1 | phage portal protein | - |
| At1D1108_RS17765 (At1D1108_34520) | - | 875895..877874 (-) | 1980 | WP_233283705.1 | terminase gpA endonuclease subunit | - |
| At1D1108_RS17770 (At1D1108_34530) | - | 877877..878482 (-) | 606 | WP_121557246.1 | hypothetical protein | - |
| At1D1108_RS17775 (At1D1108_34540) | - | 878837..879613 (-) | 777 | WP_121557247.1 | hypothetical protein | - |
| At1D1108_RS17780 (At1D1108_34550) | - | 880037..881857 (-) | 1821 | WP_121557248.1 | DNA primase family protein | - |
| At1D1108_RS17785 (At1D1108_34560) | - | 881858..882955 (-) | 1098 | WP_233283678.1 | hypothetical protein | - |
| At1D1108_RS17790 (At1D1108_34570) | - | 883175..884386 (-) | 1212 | WP_121557249.1 | phosphoadenosine phosphosulfate reductase family protein | - |
| At1D1108_RS17795 (At1D1108_34580) | - | 884383..886476 (-) | 2094 | WP_233283679.1 | DNA cytosine methyltransferase | - |
| At1D1108_RS27945 | - | 886514..886930 (-) | 417 | WP_162995240.1 | hypothetical protein | - |
| At1D1108_RS17800 (At1D1108_34590) | - | 886930..887508 (-) | 579 | WP_121557251.1 | hypothetical protein | - |
| At1D1108_RS17805 (At1D1108_34600) | - | 887505..887855 (-) | 351 | WP_121557252.1 | hypothetical protein | - |
| At1D1108_RS17810 (At1D1108_34610) | - | 887852..890461 (-) | 2610 | WP_121557253.1 | DNA methyltransferase | - |
| At1D1108_RS17815 (At1D1108_34620) | - | 890461..890646 (-) | 186 | WP_121557254.1 | hypothetical protein | - |
| At1D1108_RS17820 (At1D1108_34630) | - | 890643..891092 (-) | 450 | WP_121557255.1 | GNAT family N-acetyltransferase | - |
| At1D1108_RS17825 (At1D1108_34640) | - | 891089..891589 (-) | 501 | WP_121557256.1 | hypothetical protein | - |
| At1D1108_RS17830 (At1D1108_34650) | - | 891735..892031 (+) | 297 | WP_121557257.1 | hypothetical protein | - |
| At1D1108_RS17840 (At1D1108_34660) | - | 892304..892549 (-) | 246 | WP_121557593.1 | hypothetical protein | - |
| At1D1108_RS17845 (At1D1108_34670) | - | 892636..893337 (+) | 702 | WP_121557258.1 | S24 family peptidase | - |
| At1D1108_RS17855 (At1D1108_34690) | - | 893899..894093 (+) | 195 | WP_121557260.1 | hypothetical protein | - |
| At1D1108_RS17860 (At1D1108_34700) | - | 894161..894346 (+) | 186 | WP_121557261.1 | hypothetical protein | - |
| At1D1108_RS17865 (At1D1108_34710) | - | 894346..895053 (+) | 708 | WP_174075465.1 | hypothetical protein | - |
| At1D1108_RS17870 (At1D1108_34720) | - | 895050..895340 (+) | 291 | WP_121557262.1 | helix-turn-helix domain-containing protein | - |
| At1D1108_RS17875 (At1D1108_34730) | - | 895333..896490 (+) | 1158 | WP_121557263.1 | DUF5131 family protein | - |
| At1D1108_RS17880 (At1D1108_34740) | ssb | 896490..896981 (+) | 492 | WP_121557264.1 | single-stranded DNA-binding protein | Machinery gene |
| At1D1108_RS17885 (At1D1108_34750) | - | 897017..897373 (+) | 357 | WP_121557265.1 | hypothetical protein | - |
| At1D1108_RS17890 (At1D1108_34760) | - | 897524..898327 (+) | 804 | WP_233283680.1 | DUF2303 family protein | - |
| At1D1108_RS17895 (At1D1108_34770) | - | 898327..898851 (+) | 525 | WP_121557267.1 | hypothetical protein | - |
| At1D1108_RS17900 (At1D1108_34780) | dnaN | 898854..899966 (+) | 1113 | WP_121557268.1 | DNA polymerase III subunit beta | - |
| At1D1108_RS17905 (At1D1108_34790) | - | 899977..900204 (+) | 228 | WP_162995267.1 | hypothetical protein | - |
| At1D1108_RS28135 (At1D1108_34800) | - | 900191..901159 (+) | 969 | WP_174075467.1 | hypothetical protein | - |
| At1D1108_RS17915 (At1D1108_34810) | - | 901163..901675 (+) | 513 | WP_121557270.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 163 a.a. Molecular weight: 17837.70 Da Isoelectric Point: 6.4882
>NTDB_id=320399 At1D1108_RS17880 WP_121557264.1 896490..896981(+) (ssb) [Agrobacterium tumefaciens strain 1D1108]
MAGSVNKVILIGHLGADPEIRQTQAGAGIASLRLATSESWRDKESGERKERTEWHSVVVFTEGLVKVCEQYLKKGAKVYI
EGKLQTRKWQHSDGGDRYTTEVVLNGFNATLTMLDSQGGGNRPPPASDPDQYGRQPSRQSGSSGSNPSTGRDFSHDMDDD
IPF
MAGSVNKVILIGHLGADPEIRQTQAGAGIASLRLATSESWRDKESGERKERTEWHSVVVFTEGLVKVCEQYLKKGAKVYI
EGKLQTRKWQHSDGGDRYTTEVVLNGFNATLTMLDSQGGGNRPPPASDPDQYGRQPSRQSGSSGSNPSTGRDFSHDMDDD
IPF
Nucleotide
Download Length: 492 bp
>NTDB_id=320399 At1D1108_RS17880 WP_121557264.1 896490..896981(+) (ssb) [Agrobacterium tumefaciens strain 1D1108]
ATGGCCGGCTCGGTCAACAAAGTCATTCTCATCGGACACCTCGGCGCCGATCCGGAAATCCGACAGACACAGGCGGGTGC
CGGAATTGCGAGCCTACGCCTCGCCACATCCGAAAGCTGGCGGGACAAGGAAAGCGGAGAGCGCAAAGAGCGCACCGAGT
GGCACAGCGTCGTCGTCTTTACTGAAGGTCTCGTCAAGGTGTGCGAGCAGTACCTCAAGAAGGGCGCCAAGGTTTACATC
GAAGGCAAACTGCAAACCCGAAAATGGCAGCACTCCGACGGCGGAGACCGATACACAACCGAAGTAGTGCTCAACGGTTT
CAACGCGACACTAACGATGCTCGATAGCCAGGGCGGCGGCAACCGGCCACCGCCGGCGTCCGATCCCGATCAATACGGGC
GGCAGCCGAGCCGGCAATCTGGCTCCAGCGGTTCAAACCCGAGCACCGGCCGCGATTTCAGCCACGACATGGATGACGAC
ATTCCGTTCTGA
ATGGCCGGCTCGGTCAACAAAGTCATTCTCATCGGACACCTCGGCGCCGATCCGGAAATCCGACAGACACAGGCGGGTGC
CGGAATTGCGAGCCTACGCCTCGCCACATCCGAAAGCTGGCGGGACAAGGAAAGCGGAGAGCGCAAAGAGCGCACCGAGT
GGCACAGCGTCGTCGTCTTTACTGAAGGTCTCGTCAAGGTGTGCGAGCAGTACCTCAAGAAGGGCGCCAAGGTTTACATC
GAAGGCAAACTGCAAACCCGAAAATGGCAGCACTCCGACGGCGGAGACCGATACACAACCGAAGTAGTGCTCAACGGTTT
CAACGCGACACTAACGATGCTCGATAGCCAGGGCGGCGGCAACCGGCCACCGCCGGCGTCCGATCCCGATCAATACGGGC
GGCAGCCGAGCCGGCAATCTGGCTCCAGCGGTTCAAACCCGAGCACCGGCCGCGATTTCAGCCACGACATGGATGACGAC
ATTCCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
46.821 |
100 |
0.497 |
| ssb | Glaesserella parasuis strain SC1401 |
42.473 |
100 |
0.485 |
| ssb | Neisseria meningitidis MC58 |
37.714 |
100 |
0.405 |
| ssb | Neisseria gonorrhoeae MS11 |
37.714 |
100 |
0.405 |