Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   D4H43_RS07695 Genome accession   NZ_CP032911
Coordinates   1585868..1585981 (-) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain 19-A-EK3     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1580868..1590981
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D4H43_RS07675 - 1581525..1582937 (-) 1413 WP_139544546.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  D4H43_RS07680 comB10 1583007..1584143 (-) 1137 WP_139544547.1 DNA type IV secretion system protein ComB10 Machinery gene
  D4H43_RS07685 comB9 1584136..1585134 (-) 999 WP_139544548.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  D4H43_RS07690 comB8 1585134..1585871 (-) 738 WP_139544549.1 virB8 family protein Machinery gene
  D4H43_RS07695 comB7 1585868..1585981 (-) 114 WP_001217873.1 hypothetical protein Machinery gene
  D4H43_RS07700 comB6 1585997..1587052 (-) 1056 WP_139544664.1 P-type conjugative transfer protein TrbL Machinery gene
  D4H43_RS07705 - 1587060..1588064 (-) 1005 WP_139544550.1 PDZ domain-containing protein -
  D4H43_RS07710 - 1588064..1588366 (-) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  D4H43_RS07715 panD 1588369..1588722 (-) 354 WP_000142278.1 aspartate 1-decarboxylase -
  D4H43_RS07720 - 1588712..1590937 (-) 2226 WP_139548842.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=320320 D4H43_RS07695 WP_001217873.1 1585868..1585981(-) (comB7) [Helicobacter pylori strain 19-A-EK3]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=320320 D4H43_RS07695 WP_001217873.1 1585868..1585981(-) (comB7) [Helicobacter pylori strain 19-A-EK3]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1

Multiple sequence alignment