Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   D4K40_RS07470 Genome accession   NZ_CP032902
Coordinates   1512164..1512277 (-) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain 280-A-EK1     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1507164..1517277
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D4K40_RS07450 - 1507845..1509257 (-) 1413 WP_139521149.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  D4K40_RS07455 comB10 1509327..1510457 (-) 1131 WP_139521150.1 DNA type IV secretion system protein ComB10 Machinery gene
  D4K40_RS07460 comB9 1510450..1511430 (-) 981 WP_139521151.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  D4K40_RS07465 comB8 1511430..1512167 (-) 738 WP_139521152.1 virB8 family protein Machinery gene
  D4K40_RS07470 comB7 1512164..1512277 (-) 114 WP_001217873.1 hypothetical protein Machinery gene
  D4K40_RS07475 comB6 1512293..1513348 (-) 1056 WP_139521153.1 P-type conjugative transfer protein TrbL Machinery gene
  D4K40_RS07480 - 1513356..1514351 (-) 996 WP_139521154.1 PDZ domain-containing protein -
  D4K40_RS07485 - 1514351..1514653 (-) 303 WP_000347928.1 YbaB/EbfC family nucleoid-associated protein -
  D4K40_RS07490 panD 1514656..1515009 (-) 354 WP_033765057.1 aspartate 1-decarboxylase -
  D4K40_RS07495 - 1514999..1517224 (-) 2226 WP_139521155.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=320131 D4K40_RS07470 WP_001217873.1 1512164..1512277(-) (comB7) [Helicobacter pylori strain 280-A-EK1]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=320131 D4K40_RS07470 WP_001217873.1 1512164..1512277(-) (comB7) [Helicobacter pylori strain 280-A-EK1]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAACCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1

Multiple sequence alignment