Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   D9C20_RS00565 Genome accession   NZ_CP032867
Coordinates   100300..100674 (-) Length   124 a.a.
NCBI ID   WP_014480253.1    Uniprot ID   A0AA96ZSW7
Organism   Bacillus subtilis subsp. subtilis strain N4-2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 95300..105674
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9C20_RS00525 (D9C20_00525) yqhG 95632..96426 (+) 795 WP_014480249.1 YqhG family protein -
  D9C20_RS00530 (D9C20_00530) sinI 96609..96782 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  D9C20_RS00535 (D9C20_00535) sinR 96816..97151 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  D9C20_RS00540 (D9C20_00540) tasA 97244..98029 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  D9C20_RS00545 (D9C20_00545) sipW 98093..98665 (-) 573 WP_003230181.1 signal peptidase I SipW -
  D9C20_RS00550 (D9C20_00550) tapA 98649..99410 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  D9C20_RS00555 (D9C20_00555) yqzG 99682..100008 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  D9C20_RS00560 (D9C20_00560) spoIITA 100050..100229 (-) 180 WP_014480252.1 YqzE family protein -
  D9C20_RS00565 (D9C20_00565) comGG 100300..100674 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  D9C20_RS00570 (D9C20_00570) comGF 100675..101058 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  D9C20_RS00575 (D9C20_00575) comGE 101084..101431 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  D9C20_RS00580 (D9C20_00580) comGD 101415..101846 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  D9C20_RS00585 (D9C20_00585) comGC 101836..102132 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  D9C20_RS00590 (D9C20_00590) comGB 102146..103183 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  D9C20_RS00595 (D9C20_00595) comGA 103170..104240 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  D9C20_RS00600 (D9C20_00600) - 104452..104649 (-) 198 WP_014480259.1 CBS domain-containing protein -
  D9C20_RS00605 (D9C20_00605) corA 104651..105604 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14509.72 Da        Isoelectric Point: 9.2806

>NTDB_id=319770 D9C20_RS00565 WP_014480253.1 100300..100674(-) (comGG) [Bacillus subtilis subsp. subtilis strain N4-2]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=319770 D9C20_RS00565 WP_014480253.1 100300..100674(-) (comGG) [Bacillus subtilis subsp. subtilis strain N4-2]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAAAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTATTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

97.581

100

0.976

Multiple sequence alignment