Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   D9C20_RS00570 Genome accession   NZ_CP032867
Coordinates   100675..101058 (-) Length   127 a.a.
NCBI ID   WP_014480254.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis strain N4-2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 95675..106058
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9C20_RS00530 (D9C20_00530) sinI 96609..96782 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  D9C20_RS00535 (D9C20_00535) sinR 96816..97151 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  D9C20_RS00540 (D9C20_00540) tasA 97244..98029 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  D9C20_RS00545 (D9C20_00545) sipW 98093..98665 (-) 573 WP_003230181.1 signal peptidase I SipW -
  D9C20_RS00550 (D9C20_00550) tapA 98649..99410 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  D9C20_RS00555 (D9C20_00555) yqzG 99682..100008 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  D9C20_RS00560 (D9C20_00560) spoIITA 100050..100229 (-) 180 WP_014480252.1 YqzE family protein -
  D9C20_RS00565 (D9C20_00565) comGG 100300..100674 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  D9C20_RS00570 (D9C20_00570) comGF 100675..101058 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  D9C20_RS00575 (D9C20_00575) comGE 101084..101431 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  D9C20_RS00580 (D9C20_00580) comGD 101415..101846 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  D9C20_RS00585 (D9C20_00585) comGC 101836..102132 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  D9C20_RS00590 (D9C20_00590) comGB 102146..103183 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  D9C20_RS00595 (D9C20_00595) comGA 103170..104240 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  D9C20_RS00600 (D9C20_00600) - 104452..104649 (-) 198 WP_014480259.1 CBS domain-containing protein -
  D9C20_RS00605 (D9C20_00605) corA 104651..105604 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14329.42 Da        Isoelectric Point: 5.8949

>NTDB_id=319771 D9C20_RS00570 WP_014480254.1 100675..101058(-) (comGF) [Bacillus subtilis subsp. subtilis strain N4-2]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=319771 D9C20_RS00570 WP_014480254.1 100675..101058(-) (comGF) [Bacillus subtilis subsp. subtilis strain N4-2]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984


Multiple sequence alignment