Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | D9C20_RS00530 | Genome accession | NZ_CP032867 |
| Coordinates | 96609..96782 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis subsp. subtilis strain N4-2 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 91609..101782
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D9C20_RS00515 (D9C20_00515) | gcvT | 92408..93496 (-) | 1089 | WP_014480247.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| D9C20_RS00520 (D9C20_00520) | hepAA | 93938..95611 (+) | 1674 | WP_014480248.1 | SNF2-related protein | - |
| D9C20_RS00525 (D9C20_00525) | yqhG | 95632..96426 (+) | 795 | WP_014480249.1 | YqhG family protein | - |
| D9C20_RS00530 (D9C20_00530) | sinI | 96609..96782 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| D9C20_RS00535 (D9C20_00535) | sinR | 96816..97151 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| D9C20_RS00540 (D9C20_00540) | tasA | 97244..98029 (-) | 786 | WP_014480250.1 | biofilm matrix protein TasA | - |
| D9C20_RS00545 (D9C20_00545) | sipW | 98093..98665 (-) | 573 | WP_003230181.1 | signal peptidase I SipW | - |
| D9C20_RS00550 (D9C20_00550) | tapA | 98649..99410 (-) | 762 | WP_014480251.1 | amyloid fiber anchoring/assembly protein TapA | - |
| D9C20_RS00555 (D9C20_00555) | yqzG | 99682..100008 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| D9C20_RS00560 (D9C20_00560) | spoIITA | 100050..100229 (-) | 180 | WP_014480252.1 | YqzE family protein | - |
| D9C20_RS00565 (D9C20_00565) | comGG | 100300..100674 (-) | 375 | WP_014480253.1 | ComG operon protein ComGG | Machinery gene |
| D9C20_RS00570 (D9C20_00570) | comGF | 100675..101058 (-) | 384 | WP_014480254.1 | ComG operon protein ComGF | Machinery gene |
| D9C20_RS00575 (D9C20_00575) | comGE | 101084..101431 (-) | 348 | WP_014480255.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=319768 D9C20_RS00530 WP_003230187.1 96609..96782(+) (sinI) [Bacillus subtilis subsp. subtilis strain N4-2]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=319768 D9C20_RS00530 WP_003230187.1 96609..96782(+) (sinI) [Bacillus subtilis subsp. subtilis strain N4-2]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |