Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   D9C16_RS01030 Genome accession   NZ_CP032861
Coordinates   169552..169926 (+) Length   124 a.a.
NCBI ID   WP_014480253.1    Uniprot ID   A0AA96ZSW7
Organism   Bacillus subtilis subsp. subtilis strain N1-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 164552..174926
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9C16_RS00990 (D9C16_00990) corA 164622..165575 (+) 954 WP_014480260.1 magnesium transporter CorA -
  D9C16_RS00995 (D9C16_00995) - 165577..165774 (+) 198 WP_014480259.1 CBS domain-containing protein -
  D9C16_RS01000 (D9C16_01000) comGA 165986..167056 (+) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  D9C16_RS01005 (D9C16_01005) comGB 167043..168080 (+) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  D9C16_RS01010 (D9C16_01010) comGC 168094..168390 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  D9C16_RS01015 (D9C16_01015) comGD 168380..168811 (+) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  D9C16_RS01020 (D9C16_01020) comGE 168795..169142 (+) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  D9C16_RS01025 (D9C16_01025) comGF 169168..169551 (+) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  D9C16_RS01030 (D9C16_01030) comGG 169552..169926 (+) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  D9C16_RS01035 (D9C16_01035) spoIITA 169997..170176 (+) 180 WP_014480252.1 YqzE family protein -
  D9C16_RS01040 (D9C16_01040) yqzG 170218..170544 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  D9C16_RS01045 (D9C16_01045) tapA 170816..171577 (+) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  D9C16_RS01050 (D9C16_01050) sipW 171561..172133 (+) 573 WP_003230181.1 signal peptidase I SipW -
  D9C16_RS01055 (D9C16_01055) tasA 172197..172982 (+) 786 WP_014480250.1 biofilm matrix protein TasA -
  D9C16_RS01060 (D9C16_01060) sinR 173075..173410 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  D9C16_RS01065 (D9C16_01065) sinI 173444..173617 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  D9C16_RS01070 (D9C16_01070) yqhG 173800..174594 (-) 795 WP_014480249.1 YqhG family protein -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14509.72 Da        Isoelectric Point: 9.2806

>NTDB_id=319542 D9C16_RS01030 WP_014480253.1 169552..169926(+) (comGG) [Bacillus subtilis subsp. subtilis strain N1-1]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=319542 D9C16_RS01030 WP_014480253.1 169552..169926(+) (comGG) [Bacillus subtilis subsp. subtilis strain N1-1]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAAAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTATTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains


Predicted by InterProScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

97.581

100

0.976


Multiple sequence alignment