Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | D9C16_RS01065 | Genome accession | NZ_CP032861 |
| Coordinates | 173444..173617 (-) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis subsp. subtilis strain N1-1 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 168444..178617
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D9C16_RS01020 (D9C16_01020) | comGE | 168795..169142 (+) | 348 | WP_014480255.1 | ComG operon protein 5 | Machinery gene |
| D9C16_RS01025 (D9C16_01025) | comGF | 169168..169551 (+) | 384 | WP_014480254.1 | ComG operon protein ComGF | Machinery gene |
| D9C16_RS01030 (D9C16_01030) | comGG | 169552..169926 (+) | 375 | WP_014480253.1 | ComG operon protein ComGG | Machinery gene |
| D9C16_RS01035 (D9C16_01035) | spoIITA | 169997..170176 (+) | 180 | WP_014480252.1 | YqzE family protein | - |
| D9C16_RS01040 (D9C16_01040) | yqzG | 170218..170544 (-) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| D9C16_RS01045 (D9C16_01045) | tapA | 170816..171577 (+) | 762 | WP_014480251.1 | amyloid fiber anchoring/assembly protein TapA | - |
| D9C16_RS01050 (D9C16_01050) | sipW | 171561..172133 (+) | 573 | WP_003230181.1 | signal peptidase I SipW | - |
| D9C16_RS01055 (D9C16_01055) | tasA | 172197..172982 (+) | 786 | WP_014480250.1 | biofilm matrix protein TasA | - |
| D9C16_RS01060 (D9C16_01060) | sinR | 173075..173410 (-) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| D9C16_RS01065 (D9C16_01065) | sinI | 173444..173617 (-) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| D9C16_RS01070 (D9C16_01070) | yqhG | 173800..174594 (-) | 795 | WP_014480249.1 | YqhG family protein | - |
| D9C16_RS01075 (D9C16_01075) | hepAA | 174615..176288 (-) | 1674 | WP_014480248.1 | SNF2-related protein | - |
| D9C16_RS01080 (D9C16_01080) | gcvT | 176730..177818 (+) | 1089 | WP_014480247.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=319544 D9C16_RS01065 WP_003230187.1 173444..173617(-) (sinI) [Bacillus subtilis subsp. subtilis strain N1-1]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=319544 D9C16_RS01065 WP_003230187.1 173444..173617(-) (sinI) [Bacillus subtilis subsp. subtilis strain N1-1]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |