Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | GDIA_RS02720 | Genome accession | NC_011365 |
| Coordinates | 595463..596017 (+) | Length | 184 a.a. |
| NCBI ID | WP_012553188.1 | Uniprot ID | A0A7W4FBK9 |
| Organism | Gluconacetobacter diazotrophicus PA1 5 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 595463..638242 | 595463..596017 | within | 0 |
Gene organization within MGE regions
Location: 595463..638242
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GDIA_RS02720 (Gdia_0539) | ssb | 595463..596017 (+) | 555 | WP_012553188.1 | single-stranded DNA-binding protein | Machinery gene |
| GDIA_RS02725 (Gdia_0540) | gyrA | 596185..598977 (+) | 2793 | WP_012226218.1 | DNA gyrase subunit A | - |
| GDIA_RS02730 (Gdia_0541) | coaD | 598970..599479 (+) | 510 | WP_012226220.1 | pantetheine-phosphate adenylyltransferase | - |
| GDIA_RS02735 (Gdia_0542) | - | 599538..600023 (+) | 486 | WP_012226222.1 | peptidylprolyl isomerase | - |
| GDIA_RS02745 (Gdia_0543) | - | 600274..601515 (+) | 1242 | WP_012553189.1 | tyrosine-type recombinase/integrase | - |
| GDIA_RS18195 (Gdia_0544) | - | 601711..603342 (-) | 1632 | WP_012553190.1 | VapE domain-containing protein | - |
| GDIA_RS18930 (Gdia_0546) | - | 604743..605525 (-) | 783 | WP_012553192.1 | hypothetical protein | - |
| GDIA_RS18050 (Gdia_0547) | - | 605714..606181 (+) | 468 | WP_012553193.1 | DUF6998 domain-containing protein | - |
| GDIA_RS02750 | - | 606881..607378 (+) | 498 | WP_043458628.1 | hypothetical protein | - |
| GDIA_RS02755 (Gdia_0550) | - | 607650..607859 (-) | 210 | WP_012553196.1 | hypothetical protein | - |
| GDIA_RS18935 (Gdia_0551) | - | 607976..608656 (-) | 681 | WP_012553197.1 | hypothetical protein | - |
| GDIA_RS02760 (Gdia_0552) | - | 608906..609340 (-) | 435 | WP_012553198.1 | hypothetical protein | - |
| GDIA_RS02765 (Gdia_0553) | - | 609403..609909 (-) | 507 | WP_012553199.1 | hypothetical protein | - |
| GDIA_RS02770 (Gdia_0554) | - | 610268..610858 (-) | 591 | WP_012553200.1 | hypothetical protein | - |
| GDIA_RS18940 | - | 611066..611431 (+) | 366 | WP_157864097.1 | hypothetical protein | - |
| GDIA_RS18205 (Gdia_0555) | - | 611462..612808 (-) | 1347 | WP_012553201.1 | phage portal protein | - |
| GDIA_RS19850 | - | 613438..613803 (+) | 366 | WP_407635500.1 | HNH endonuclease | - |
| GDIA_RS18945 | - | 614094..614447 (-) | 354 | WP_157864099.1 | hypothetical protein | - |
| GDIA_RS18215 (Gdia_0557) | - | 614459..615238 (-) | 780 | WP_012553202.1 | DNA circularization N-terminal domain-containing protein | - |
| GDIA_RS18055 | - | 615274..615735 (-) | 462 | WP_049762851.1 | hypothetical protein | - |
| GDIA_RS18950 (Gdia_0558) | - | 615755..616948 (-) | 1194 | WP_012553203.1 | hypothetical protein | - |
| GDIA_RS18955 | - | 617177..617362 (-) | 186 | WP_157864101.1 | hypothetical protein | - |
| GDIA_RS18960 | - | 617421..617801 (-) | 381 | WP_157864103.1 | phage tail tube protein | - |
| GDIA_RS18965 (Gdia_0559) | - | 617923..619062 (-) | 1140 | WP_012553204.1 | Mu-like protein prophage tail sheath protein gpL-like protein | - |
| GDIA_RS18970 | - | 619140..619697 (+) | 558 | WP_157864105.1 | hypothetical protein | - |
| GDIA_RS18975 | - | 619684..620073 (-) | 390 | WP_157864107.1 | hypothetical protein | - |
| GDIA_RS18980 (Gdia_0560) | - | 620462..621109 (-) | 648 | WP_012553205.1 | hypothetical protein | - |
| GDIA_RS18985 | - | 621109..621264 (-) | 156 | WP_157864109.1 | hypothetical protein | - |
| GDIA_RS18990 (Gdia_0561) | - | 621303..623486 (-) | 2184 | WP_012553206.1 | hypothetical protein | - |
| GDIA_RS18220 (Gdia_0562) | - | 623581..624999 (+) | 1419 | WP_012553207.1 | phage major capsid protein | - |
| GDIA_RS18995 | - | 625234..625563 (-) | 330 | WP_157864111.1 | hypothetical protein | - |
| GDIA_RS19855 | - | 625586..625981 (-) | 396 | WP_043458634.1 | HNH endonuclease | - |
| GDIA_RS18230 | - | 625974..626423 (-) | 450 | WP_081434692.1 | phage GP46 family protein | - |
| GDIA_RS19005 | - | 626423..626845 (-) | 423 | WP_157864115.1 | hypothetical protein | - |
| GDIA_RS18235 (Gdia_0563) | - | 626865..628619 (-) | 1755 | WP_012553208.1 | terminase large subunit | - |
| GDIA_RS19010 | - | 628700..629011 (+) | 312 | WP_157864117.1 | hypothetical protein | - |
| GDIA_RS19860 | - | 629013..629414 (+) | 402 | WP_407635498.1 | hypothetical protein | - |
| GDIA_RS19015 | - | 629424..629816 (+) | 393 | WP_157864119.1 | hypothetical protein | - |
| GDIA_RS18240 (Gdia_0564) | - | 630173..631264 (+) | 1092 | WP_012553209.1 | baseplate J/gp47 family protein | - |
| GDIA_RS18245 (Gdia_0565) | - | 631277..631852 (+) | 576 | WP_081434693.1 | putative phage tail protein | - |
| GDIA_RS18250 (Gdia_0566) | - | 631882..632538 (+) | 657 | WP_012553210.1 | HK97 family phage prohead protease | - |
| GDIA_RS18255 | - | 632732..633166 (+) | 435 | WP_043458636.1 | lysozyme | - |
| GDIA_RS19020 (Gdia_0568) | - | 633643..634878 (+) | 1236 | WP_157864121.1 | hypothetical protein | - |
| GDIA_RS18260 | - | 634888..635436 (+) | 549 | WP_081434694.1 | phage baseplate assembly protein | - |
| GDIA_RS18265 (Gdia_0569) | - | 635447..638242 (+) | 2796 | WP_012553213.1 | glycoside hydrolase TIM-barrel-like domain-containing protein | - |
Sequence
Protein
Download Length: 184 a.a. Molecular weight: 19272.06 Da Isoelectric Point: 5.8317
>NTDB_id=31716 GDIA_RS02720 WP_012553188.1 595463..596017(+) (ssb) [Gluconacetobacter diazotrophicus PA1 5]
MAGSVNKVILVGNLGKDPEVRNSQAGAKIVSLTLATSDTWNDRASGERRERTEWHRVVIFNERLADVAERFLRKGRKVYL
EGTLQTRKWTDQSGQERYTTEVVIDRFRGELVLLDSNRGGESGDDAGGGGYGGGYSAPSAPRQIGGGRGGSAGGPGGGGA
GGGNPGGGWDAPHGGSDLDDEIPF
MAGSVNKVILVGNLGKDPEVRNSQAGAKIVSLTLATSDTWNDRASGERRERTEWHRVVIFNERLADVAERFLRKGRKVYL
EGTLQTRKWTDQSGQERYTTEVVIDRFRGELVLLDSNRGGESGDDAGGGGYGGGYSAPSAPRQIGGGRGGSAGGPGGGGA
GGGNPGGGWDAPHGGSDLDDEIPF
Nucleotide
Download Length: 555 bp
>NTDB_id=31716 GDIA_RS02720 WP_012553188.1 595463..596017(+) (ssb) [Gluconacetobacter diazotrophicus PA1 5]
ATGGCGGGTAGCGTCAACAAGGTCATTCTCGTGGGTAATCTGGGCAAGGACCCCGAAGTCAGGAACAGCCAGGCCGGCGC
CAAGATCGTGTCGCTGACGCTGGCGACCAGCGACACGTGGAATGACCGTGCGTCCGGCGAACGGCGCGAGCGCACGGAAT
GGCATCGGGTCGTCATCTTCAACGAACGCCTGGCGGACGTGGCCGAGCGGTTCCTGCGCAAGGGCCGCAAGGTCTATCTG
GAAGGCACGCTGCAGACCCGCAAATGGACCGACCAGTCCGGCCAGGAACGCTACACGACCGAGGTCGTGATAGACCGCTT
CCGTGGCGAACTGGTGCTGCTGGACAGCAACCGGGGCGGCGAATCCGGTGACGATGCCGGCGGCGGCGGATATGGCGGCG
GGTATTCCGCGCCGTCCGCGCCCCGGCAGATCGGCGGTGGCCGCGGCGGCAGCGCCGGGGGTCCCGGCGGGGGCGGCGCG
GGCGGCGGCAATCCCGGCGGCGGCTGGGACGCACCGCATGGCGGCAGCGACCTGGACGACGAAATCCCGTTCTAG
ATGGCGGGTAGCGTCAACAAGGTCATTCTCGTGGGTAATCTGGGCAAGGACCCCGAAGTCAGGAACAGCCAGGCCGGCGC
CAAGATCGTGTCGCTGACGCTGGCGACCAGCGACACGTGGAATGACCGTGCGTCCGGCGAACGGCGCGAGCGCACGGAAT
GGCATCGGGTCGTCATCTTCAACGAACGCCTGGCGGACGTGGCCGAGCGGTTCCTGCGCAAGGGCCGCAAGGTCTATCTG
GAAGGCACGCTGCAGACCCGCAAATGGACCGACCAGTCCGGCCAGGAACGCTACACGACCGAGGTCGTGATAGACCGCTT
CCGTGGCGAACTGGTGCTGCTGGACAGCAACCGGGGCGGCGAATCCGGTGACGATGCCGGCGGCGGCGGATATGGCGGCG
GGTATTCCGCGCCGTCCGCGCCCCGGCAGATCGGCGGTGGCCGCGGCGGCAGCGCCGGGGGTCCCGGCGGGGGCGGCGCG
GGCGGCGGCAATCCCGGCGGCGGCTGGGACGCACCGCATGGCGGCAGCGACCTGGACGACGAAATCCCGTTCTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
46.907 |
100 |
0.495 |
| ssb | Vibrio cholerae strain A1552 |
44.022 |
100 |
0.44 |
| ssb | Neisseria gonorrhoeae MS11 |
38.378 |
100 |
0.386 |
| ssb | Neisseria meningitidis MC58 |
37.5 |
100 |
0.375 |