Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   D4J00_RS06980 Genome accession   NZ_CP032478
Coordinates   1422704..1422817 (-) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain 25-A-EK9     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1417704..1427817
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D4J00_RS06960 - 1418382..1419800 (-) 1419 WP_139519864.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  D4J00_RS06965 comB10 1419870..1421000 (-) 1131 WP_139519866.1 DNA type IV secretion system protein ComB10 Machinery gene
  D4J00_RS06970 comB9 1420993..1421970 (-) 978 WP_139519868.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  D4J00_RS06975 comB8 1421970..1422707 (-) 738 WP_139519870.1 virB8 family protein Machinery gene
  D4J00_RS06980 comB7 1422704..1422817 (-) 114 WP_001217873.1 hypothetical protein Machinery gene
  D4J00_RS06985 comB6 1422833..1423888 (-) 1056 WP_139520044.1 P-type conjugative transfer protein TrbL Machinery gene
  D4J00_RS06990 - 1423896..1424891 (-) 996 WP_139520046.1 PDZ domain-containing protein -
  D4J00_RS06995 - 1424891..1425193 (-) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  D4J00_RS07000 panD 1425196..1425549 (-) 354 WP_024368743.1 aspartate 1-decarboxylase -
  D4J00_RS07005 - 1425539..1427764 (-) 2226 WP_139519872.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=316279 D4J00_RS06980 WP_001217873.1 1422704..1422817(-) (comB7) [Helicobacter pylori strain 25-A-EK9]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=316279 D4J00_RS06980 WP_001217873.1 1422704..1422817(-) (comB7) [Helicobacter pylori strain 25-A-EK9]
ATGAGAATTTTTTTTGTTATCATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1

Multiple sequence alignment