Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   D0819_RS08315 Genome accession   NZ_CP031784
Coordinates   1589430..1589813 (-) Length   127 a.a.
NCBI ID   WP_031315212.1    Uniprot ID   -
Organism   Bacillus subtilis strain HMNig-2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1584430..1594813
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D0819_RS08275 (D0819_08290) sinI 1585363..1585536 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  D0819_RS08280 (D0819_08295) sinR 1585570..1585905 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  D0819_RS08285 (D0819_08300) tasA 1585998..1586783 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  D0819_RS08290 (D0819_08305) sipW 1586848..1587420 (-) 573 WP_003246088.1 signal peptidase I SipW -
  D0819_RS08295 (D0819_08310) tapA 1587404..1588165 (-) 762 WP_077671431.1 amyloid fiber anchoring/assembly protein TapA -
  D0819_RS08300 (D0819_08315) yqzG 1588436..1588762 (+) 327 WP_021480018.1 YqzG/YhdC family protein -
  D0819_RS08305 (D0819_08320) spoIITA 1588804..1588983 (-) 180 WP_014480252.1 YqzE family protein -
  D0819_RS08310 (D0819_08325) comGG 1589055..1589429 (-) 375 WP_021480019.1 ComG operon protein ComGG Machinery gene
  D0819_RS08315 (D0819_08330) comGF 1589430..1589813 (-) 384 WP_031315212.1 ComG operon protein ComGF Machinery gene
  D0819_RS08320 (D0819_08335) comGE 1589839..1590186 (-) 348 WP_021480020.1 ComG operon protein 5 Machinery gene
  D0819_RS08325 (D0819_08340) comGD 1590170..1590601 (-) 432 WP_021480021.1 comG operon protein ComGD Machinery gene
  D0819_RS08330 (D0819_08345) comGC 1590591..1590887 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  D0819_RS08335 (D0819_08350) comGB 1590901..1591938 (-) 1038 WP_021480022.1 comG operon protein ComGB Machinery gene
  D0819_RS08340 (D0819_08355) comGA 1591925..1592995 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  D0819_RS21685 - 1593284..1593421 (-) 138 WP_021480024.1 hypothetical protein -
  D0819_RS08350 (D0819_08365) corA 1593423..1594376 (-) 954 WP_015483432.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14329.42 Da        Isoelectric Point: 5.8949

>NTDB_id=311374 D0819_RS08315 WP_031315212.1 1589430..1589813(-) (comGF) [Bacillus subtilis strain HMNig-2]
MLISGSLAAIFHLFLSRQQEHEGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=311374 D0819_RS08315 WP_031315212.1 1589430..1589813(-) (comGF) [Bacillus subtilis strain HMNig-2]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTATCTCGACAGCAGGAACATGAGGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984


Multiple sequence alignment