Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   D0819_RS08275 Genome accession   NZ_CP031784
Coordinates   1585363..1585536 (+) Length   57 a.a.
NCBI ID   WP_014477323.1    Uniprot ID   -
Organism   Bacillus subtilis strain HMNig-2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1580363..1590536
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D0819_RS08260 (D0819_08270) gcvT 1581161..1582249 (-) 1089 WP_021480013.1 glycine cleavage system aminomethyltransferase GcvT -
  D0819_RS08265 (D0819_08275) hepAA 1582691..1584364 (+) 1674 WP_021480014.1 SNF2-related protein -
  D0819_RS08270 (D0819_08280) yqhG 1584385..1585179 (+) 795 WP_021480015.1 YqhG family protein -
  D0819_RS08275 (D0819_08290) sinI 1585363..1585536 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  D0819_RS08280 (D0819_08295) sinR 1585570..1585905 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  D0819_RS08285 (D0819_08300) tasA 1585998..1586783 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  D0819_RS08290 (D0819_08305) sipW 1586848..1587420 (-) 573 WP_003246088.1 signal peptidase I SipW -
  D0819_RS08295 (D0819_08310) tapA 1587404..1588165 (-) 762 WP_077671431.1 amyloid fiber anchoring/assembly protein TapA -
  D0819_RS08300 (D0819_08315) yqzG 1588436..1588762 (+) 327 WP_021480018.1 YqzG/YhdC family protein -
  D0819_RS08305 (D0819_08320) spoIITA 1588804..1588983 (-) 180 WP_014480252.1 YqzE family protein -
  D0819_RS08310 (D0819_08325) comGG 1589055..1589429 (-) 375 WP_021480019.1 ComG operon protein ComGG Machinery gene
  D0819_RS08315 (D0819_08330) comGF 1589430..1589813 (-) 384 WP_031315212.1 ComG operon protein ComGF Machinery gene
  D0819_RS08320 (D0819_08335) comGE 1589839..1590186 (-) 348 WP_021480020.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6633.58 Da        Isoelectric Point: 6.7231

>NTDB_id=311371 D0819_RS08275 WP_014477323.1 1585363..1585536(+) (sinI) [Bacillus subtilis strain HMNig-2]
MKNAKQEHFELDQEWVELMMEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=311371 D0819_RS08275 WP_014477323.1 1585363..1585536(+) (sinI) [Bacillus subtilis strain HMNig-2]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTGATGATGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterProScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

98.246

100

0.982

Multiple sequence alignment