Detailed information NTG0311272

Bioinformatically predicted

Overview

• Name: ssbA
• Type: Machinery gene
• Locus tag: D0808_RS02550
• Genome accession: NZ_CP031783
• Coordinates: 501780..502298 (-)
• Length: 172 a.a.
• NCBI ID: WP_003219228.1
• Uniprot ID: A0A063XE16
• Organism: Bacillus subtilis strain MENO2 voucher National Research Centre
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	490745..502626	501780..502298	within	0

Gene organization within MGE regions

Location: 490745..502626

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
D0808_RS02485 (D0808_02530)	yyaQ	490745..491101 (+)	357	WP_021481096.1	MmcQ/YjbR family DNA-binding protein	-
D0808_RS02490 (D0808_02535)	yyaP	491261..491827 (+)	567	WP_077670821.1	dihydrofolate reductase family protein	-
D0808_RS02495 (D0808_02540)	-	492104..492266 (+)	163	Protein_502	DUF255 domain-containing protein	-
D0808_RS02500 (D0808_02545)	tet(L)	492369..493745 (-)	1377	WP_153255561.1	tetracycline efflux MFS transporter Tet(L)	-
D0808_RS21230	tetL	493779..493841 (-)	63	WP_106489641.1	tetracycline resistance efflux system leader peptide	-
D0808_RS02510 (D0808_02555)	yyaL	494094..496163 (+)	2070	WP_153255563.1	thioredoxin domain-containing protein	-
D0808_RS02515 (D0808_02560)	yyaK	496160..497059 (-)	900	WP_015250787.1	type II CAAX endopeptidase family protein	-
D0808_RS02520 (D0808_02565)	yyaJ	497285..498640 (+)	1356	WP_014481501.1	MFS transporter	-
D0808_RS02525 (D0808_02570)	maa	498674..499228 (-)	555	WP_032722825.1	sugar O-acetyltransferase	-
D0808_RS02530 (D0808_02575)	yyaH	499244..499624 (-)	381	WP_101169974.1	VOC family protein	-
D0808_RS02535 (D0808_02580)	ccpB	499680..500615 (-)	936	WP_101169975.1	transcriptional regulator CcpB	-
D0808_RS02540 (D0808_02585)	xth	500675..501433 (-)	759	WP_003226843.1	exodeoxyribonuclease III	-
D0808_RS02545 (D0808_02590)	rpsR	501497..501736 (-)	240	WP_003219224.1	30S ribosomal protein S18	-
D0808_RS02550 (D0808_02595)	ssbA	501780..502298 (-)	519	WP_003219228.1	single-stranded DNA-binding protein SsbA	Machinery gene
D0808_RS02555 (D0808_02600)	rpsF	502339..502626 (-)	288	WP_003244064.1	30S ribosomal protein S6	-

Sequence

Protein

• Length: 172 a.a.
• Molecular weight: 18742.31 Da
• Isoelectric Point: 4.7621

>NTDB_id=311272 D0808_RS02550 WP_003219228.1 501780..502298(-) (ssbA) [Bacillus subtilis strain MENO2 voucher National Research Centre]
MLNRVVLVGRLTKDPELRYTPNGAAVATFTLAVNRTFTNQSGEREADFINCVTWRRQAENVANFLKKGSLAGVDGRLQTR
NYENQQGQRVFVTEVQAESVQFLEPKNGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQRRNQGNSFNDDPFANDG
KPIDISDDDLPF

Nucleotide

• Length: 519 bp

>NTDB_id=311272 D0808_RS02550 WP_003219228.1 501780..502298(-) (ssbA) [Bacillus subtilis strain MENO2 voucher National Research Centre]
ATGCTTAACCGAGTTGTATTAGTCGGAAGACTGACAAAAGACCCAGAGCTTCGTTATACGCCAAACGGTGCGGCTGTTGC
TACGTTTACTCTTGCTGTGAATCGTACATTTACGAACCAGTCCGGAGAACGTGAGGCCGATTTCATTAATTGTGTCACTT
GGAGAAGACAAGCCGAAAACGTTGCAAACTTCTTGAAAAAAGGAAGCCTTGCAGGCGTAGATGGCCGTTTACAAACAAGA
AACTATGAAAACCAGCAAGGACAGCGTGTCTTCGTGACAGAGGTCCAAGCTGAAAGTGTTCAATTTCTTGAGCCGAAAAA
CGGCGGCGGTTCTGGTTCAGGTGGATACAACGAAGGAAACAGCGGCGGAGGCCAGTACTTTGGCGGAGGCCAAAATGATA
ATCCATTTGGGGGAAATCAAAACAACCAGAGACGCAATCAGGGGAACAGCTTTAATGATGACCCATTTGCCAACGACGGC
AAACCGATTGACATCTCGGATGATGATCTTCCATTCTAA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (2-103)

3D structure

• AlphaFold DB: A0A063XE16

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssbA	Bacillus subtilis subsp. subtilis str. 168	100	100	1
ssb	Latilactobacillus sakei subsp. sakei 23K	58.192	100	0.599
ssbB	Bacillus subtilis subsp. subtilis str. 168	64.151	61.628	0.395
ssb	Glaesserella parasuis strain SC1401	35.519	100	0.378