Detailed information NTG0309928

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: EYQ98_RS14025
• Genome accession: NZ_CP038186
• Coordinates: 2713255..2713692 (-)
• Length: 145 a.a.
• NCBI ID: WP_009327905.1
• Uniprot ID: Q8VQ70
• Organism: Bacillus licheniformis strain MCC 2514
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2708255..2718692

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
EYQ98_RS13975 (EYQ98_13975)	sinI	2708430..2708606 (+)	177	WP_003183444.1	anti-repressor SinI family protein	Regulator
EYQ98_RS13980 (EYQ98_13980)	sinR	2708640..2708975 (+)	336	WP_006637528.1	helix-turn-helix domain-containing protein	Regulator
EYQ98_RS13985 (EYQ98_13985)	-	2709080..2709874 (-)	795	WP_003183447.1	TasA family protein	-
EYQ98_RS13990 (EYQ98_13990)	-	2709948..2710532 (-)	585	WP_003183449.1	signal peptidase I	-
EYQ98_RS13995 (EYQ98_13995)	tapA	2710529..2711257 (-)	729	WP_003183451.1	amyloid fiber anchoring/assembly protein TapA	-
EYQ98_RS14000 (EYQ98_14000)	-	2711567..2711854 (+)	288	WP_223307118.1	YqzG/YhdC family protein	-
EYQ98_RS14005 (EYQ98_14005)	-	2711878..2712060 (-)	183	WP_003183456.1	YqzE family protein	-
EYQ98_RS14010 (EYQ98_14010)	comGG	2712149..2712514 (-)	366	WP_003183459.1	competence type IV pilus minor pilin ComGG	-
EYQ98_RS14015 (EYQ98_14015)	comGF	2712527..2713015 (-)	489	WP_011201694.1	competence type IV pilus minor pilin ComGF	-
EYQ98_RS14020 (EYQ98_14020)	comGE	2712924..2713271 (-)	348	WP_009327907.1	competence type IV pilus minor pilin ComGE	-
EYQ98_RS14025 (EYQ98_14025)	comGD	2713255..2713692 (-)	438	WP_009327905.1	competence type IV pilus minor pilin ComGD	Machinery gene
EYQ98_RS14030 (EYQ98_14030)	comGC	2713698..2713991 (-)	294	WP_003183466.1	competence type IV pilus major pilin ComGC	Machinery gene
EYQ98_RS14035 (EYQ98_14035)	comGB	2714005..2715039 (-)	1035	WP_075218359.1	competence type IV pilus assembly protein ComGB	Machinery gene
EYQ98_RS14040 (EYQ98_14040)	comGA	2715029..2716093 (-)	1065	WP_003183477.1	competence type IV pilus ATPase ComGA	Machinery gene
EYQ98_RS14045 (EYQ98_14045)	-	2716250..2717089 (-)	840	WP_003183480.1	STAS domain-containing protein	-
EYQ98_RS14055 (EYQ98_14055)	-	2717331..2717708 (-)	378	WP_003183482.1	Spx/MgsR family RNA polymerase-binding regulatory protein	-
EYQ98_RS14060 (EYQ98_14060)	-	2717917..2718162 (+)	246	WP_003183483.1	DUF2626 domain-containing protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16249.07 Da
• Isoelectric Point: 9.6739

>NTDB_id=309928 EYQ98_RS14025 WP_009327905.1 2713255..2713692(-) (comGD) [Bacillus licheniformis strain MCC 2514]
MNQKGFTLLESLTVLMIGSIMFSLLFALLPPIYEKRIVQHFVSQLEEDLLYAQQTALVRHTTVKVQFDFAGCRYIMKHSD
EGSSPELVRTYSCNIAIKKSTLKPILTFNPSGVPNQGGKIVIDTQHASFILTIYLGSGKINVQKK

Nucleotide

• Length: 438 bp

>NTDB_id=309928 EYQ98_RS14025 WP_009327905.1 2713255..2713692(-) (comGD) [Bacillus licheniformis strain MCC 2514]
ATGAATCAAAAAGGATTTACGCTTTTGGAAAGTTTAACTGTATTGATGATCGGTTCTATTATGTTCTCTCTTCTCTTTGC
TCTACTGCCTCCCATTTATGAAAAAAGAATCGTTCAGCACTTTGTCTCACAGCTTGAAGAGGATTTGCTTTACGCTCAGC
AGACGGCTCTCGTCCGCCATACGACGGTTAAGGTGCAGTTTGACTTTGCCGGCTGCCGCTATATCATGAAGCATTCGGAC
GAAGGCTCATCGCCTGAACTGGTCAGGACATACAGCTGCAATATCGCAATCAAAAAGTCGACGCTCAAACCAATTCTTAC
TTTTAATCCAAGCGGTGTTCCGAATCAAGGGGGAAAGATCGTGATCGATACACAGCATGCCTCTTTTATACTGACGATCT
ATTTAGGAAGCGGAAAGATTAATGTTCAAAAAAAATAA

Domains

Predicted by InterProScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (2-25)

3D structure

• AlphaFold DB: Q8VQ70

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	39.86	98.621	0.393