Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   ETT50_RS00685 Genome accession   NZ_CP035449
Coordinates   104255..104539 (+) Length   94 a.a.
NCBI ID   WP_032464772.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain emm56     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 99255..109539
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETT50_RS00660 (ETT50_00660) - 101201..101566 (+) 366 WP_002986560.1 DUF1033 family protein -
  ETT50_RS00665 (ETT50_00665) comGA 101659..102597 (+) 939 WP_010921798.1 competence type IV pilus ATPase ComGA Machinery gene
  ETT50_RS00670 (ETT50_00670) comGB 102533..103567 (+) 1035 WP_227874644.1 competence type IV pilus assembly protein ComGB Machinery gene
  ETT50_RS00675 (ETT50_00675) comGC 103569..103895 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  ETT50_RS00680 (ETT50_00680) comGD 103870..104298 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  ETT50_RS00685 (ETT50_00685) comGE 104255..104539 (+) 285 WP_032464772.1 competence type IV pilus minor pilin ComGE Machinery gene
  ETT50_RS00690 (ETT50_00690) comGF 104532..104966 (+) 435 WP_002992738.1 competence type IV pilus minor pilin ComGF Machinery gene
  ETT50_RS00695 (ETT50_00695) comGG 104950..105276 (+) 327 WP_010921801.1 competence type IV pilus minor pilin ComGG -
  ETT50_RS00700 (ETT50_00700) comGH 105374..106327 (+) 954 WP_010921802.1 class I SAM-dependent methyltransferase Machinery gene
  ETT50_RS00705 (ETT50_00705) - 106386..107582 (+) 1197 WP_030126459.1 acetate kinase -
  ETT50_RS00710 (ETT50_00710) - 107768..108076 (+) 309 WP_030126458.1 hypothetical protein -
  ETT50_RS00715 (ETT50_00715) proC 108159..108929 (-) 771 WP_032464773.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10640.56 Da        Isoelectric Point: 8.9043

>NTDB_id=302943 ETT50_RS00685 WP_032464772.1 104255..104539(+) (comGE) [Streptococcus pyogenes strain emm56]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKDITLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=302943 ETT50_RS00685 WP_032464772.1 104255..104539(+) (comGE) [Streptococcus pyogenes strain emm56]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATTGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGATATAACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

37.234

100

0.372


Multiple sequence alignment