Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | ABAYE_RS03235 | Genome accession | NC_010410 |
| Coordinates | 550907..551260 (-) | Length | 117 a.a. |
| NCBI ID | WP_002014678.1 | Uniprot ID | A0A0D5YEH0 |
| Organism | Acinetobacter baumannii AYE | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 548541..579874 | 550907..551260 | within | 0 |
Gene organization within MGE regions
Location: 548541..579874
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABAYE_RS03215 (ABAYE0532) | - | 548541..549608 (+) | 1068 | WP_000107854.1 | site-specific integrase | - |
| ABAYE_RS03220 (ABAYE0533) | - | 549636..549932 (-) | 297 | WP_000218943.1 | hypothetical protein | - |
| ABAYE_RS03225 (ABAYE0534) | - | 549929..550150 (-) | 222 | WP_000424605.1 | hypothetical protein | - |
| ABAYE_RS03230 (ABAYE0535) | - | 550160..550897 (-) | 738 | WP_000125747.1 | 3'-5' exonuclease | - |
| ABAYE_RS03235 (ABAYE0536) | ssb | 550907..551260 (-) | 354 | WP_002014678.1 | single-stranded DNA-binding protein | Machinery gene |
| ABAYE_RS03240 (ABAYE0537) | - | 551248..551565 (-) | 318 | WP_000049658.1 | hypothetical protein | - |
| ABAYE_RS20505 (ABAYE0538) | - | 551558..551728 (-) | 171 | WP_001015077.1 | hypothetical protein | - |
| ABAYE_RS03245 (ABAYE0539) | - | 551718..552269 (-) | 552 | WP_001178668.1 | hypothetical protein | - |
| ABAYE_RS03250 (ABAYE0540) | - | 552335..552667 (-) | 333 | WP_000632296.1 | hypothetical protein | - |
| ABAYE_RS03255 (ABAYE0541) | - | 552664..555402 (-) | 2739 | WP_002014340.1 | toprim domain-containing protein | - |
| ABAYE_RS03260 (ABAYE0542) | - | 555496..555684 (-) | 189 | WP_001043170.1 | hypothetical protein | - |
| ABAYE_RS03265 (ABAYE0543) | - | 555777..556118 (+) | 342 | WP_000786718.1 | helix-turn-helix transcriptional regulator | - |
| ABAYE_RS03270 (ABAYE0544) | - | 556163..556378 (-) | 216 | WP_000556352.1 | hypothetical protein | - |
| ABAYE_RS03275 (ABAYE0545) | - | 556503..557318 (-) | 816 | WP_001094886.1 | Rha family transcriptional regulator | - |
| ABAYE_RS03280 (ABAYE0546) | - | 557426..557620 (-) | 195 | WP_000696053.1 | hypothetical protein | - |
| ABAYE_RS03285 (ABAYE0548) | - | 557930..558808 (+) | 879 | WP_000417952.1 | BRCT domain-containing protein | - |
| ABAYE_RS03290 (ABAYE0549) | - | 558808..559089 (+) | 282 | WP_000713873.1 | hypothetical protein | - |
| ABAYE_RS03300 (ABAYE0550) | - | 559405..559605 (-) | 201 | WP_000130085.1 | TraR/DksA C4-type zinc finger protein | - |
| ABAYE_RS03305 (ABAYE0551) | - | 559602..559841 (-) | 240 | WP_000113725.1 | ogr/Delta-like zinc finger family protein | - |
| ABAYE_RS03310 (ABAYE0552) | - | 559971..561284 (-) | 1314 | WP_000483061.1 | contractile injection system protein, VgrG/Pvc8 family | - |
| ABAYE_RS03315 (ABAYE0553) | - | 561285..561725 (-) | 441 | WP_000979757.1 | phage tail protein | - |
| ABAYE_RS03320 (ABAYE0554) | - | 561731..564181 (-) | 2451 | WP_000774268.1 | phage tail tape measure protein | - |
| ABAYE_RS19575 | - | 564195..564332 (-) | 138 | WP_096903806.1 | GpE family phage tail protein | - |
| ABAYE_RS03325 (ABAYE0555) | - | 564335..564676 (-) | 342 | WP_001071615.1 | phage tail assembly protein | - |
| ABAYE_RS03330 (ABAYE0556) | - | 564743..565261 (-) | 519 | WP_001207612.1 | phage major tail tube protein | - |
| ABAYE_RS03335 (ABAYE0557) | - | 565274..566449 (-) | 1176 | WP_000963361.1 | phage tail sheath protein | - |
| ABAYE_RS03340 (ABAYE0558) | - | 566599..568551 (-) | 1953 | WP_000729646.1 | phage tail protein | - |
| ABAYE_RS03345 (ABAYE0559) | - | 568563..569168 (-) | 606 | WP_001050805.1 | phage tail protein I | - |
| ABAYE_RS03350 (ABAYE0560) | - | 569168..570070 (-) | 903 | WP_000109738.1 | baseplate J/gp47 family protein | - |
| ABAYE_RS03355 (ABAYE0561) | - | 570067..570414 (-) | 348 | WP_000987745.1 | GPW/gp25 family protein | - |
| ABAYE_RS03360 (ABAYE0562) | - | 570411..571043 (-) | 633 | WP_000990625.1 | phage baseplate assembly protein V | - |
| ABAYE_RS03365 (ABAYE0563) | - | 571116..571565 (-) | 450 | WP_001059843.1 | phage virion morphogenesis protein | - |
| ABAYE_RS03370 (ABAYE0564) | - | 571562..572089 (-) | 528 | WP_000742888.1 | phage tail protein | - |
| ABAYE_RS03375 (ABAYE0565) | - | 572086..572916 (-) | 831 | WP_000600982.1 | N-acetylmuramidase family protein | - |
| ABAYE_RS03380 (ABAYE0566) | - | 572913..573182 (-) | 270 | WP_000571491.1 | phage holin family protein | - |
| ABAYE_RS03385 (ABAYE0567) | - | 573179..573529 (-) | 351 | WP_001114936.1 | putative holin | - |
| ABAYE_RS03390 (ABAYE0568) | - | 573538..573747 (-) | 210 | WP_000659474.1 | tail protein X | - |
| ABAYE_RS03395 (ABAYE0569) | - | 573748..574200 (-) | 453 | WP_000015691.1 | head completion/stabilization protein | - |
| ABAYE_RS03400 (ABAYE0570) | gpM | 574304..575050 (-) | 747 | WP_000950641.1 | phage terminase small subunit | - |
| ABAYE_RS03405 (ABAYE0571) | - | 575061..576050 (-) | 990 | WP_001243259.1 | phage major capsid protein, P2 family | - |
| ABAYE_RS03410 (ABAYE0572) | - | 576103..576930 (-) | 828 | WP_000748563.1 | GPO family capsid scaffolding protein | - |
| ABAYE_RS03415 (ABAYE0573) | - | 577068..578876 (+) | 1809 | WP_000289875.1 | terminase family protein | - |
| ABAYE_RS03420 (ABAYE0574) | - | 578876..579874 (+) | 999 | WP_001284079.1 | phage portal protein | - |
Sequence
Protein
Download Length: 117 a.a. Molecular weight: 13365.13 Da Isoelectric Point: 9.7939
>NTDB_id=30126 ABAYE_RS03235 WP_002014678.1 550907..551260(-) (ssb) [Acinetobacter baumannii AYE]
MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQERYVTEVRAITFQSLDSLPQANPV
MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQERYVTEVRAITFQSLDSLPQANPV
Nucleotide
Download Length: 354 bp
>NTDB_id=30126 ABAYE_RS03235 WP_002014678.1 550907..551260(-) (ssb) [Acinetobacter baumannii AYE]
ATGCGCGGAATAAATAAAGTGATCTTGGTTGGAATGCTTGGTGCTAACCCAATTCCTAAACAATTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGCACTGGAGATTGGATTGAAAATACTGAGTGGC
ATCGGATTGTGGCTCACAACCGCCTAGGTGAAATTGCCTGTCAATTTCTCAAAAAAGGTTCAAAAGTTTATATCGAAGGC
TCATTACATACCCGGAAATGGACTGACCAAAATAATCAAGAACGTTACGTAACTGAAGTTAGAGCCATTACATTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
ATGCGCGGAATAAATAAAGTGATCTTGGTTGGAATGCTTGGTGCTAACCCAATTCCTAAACAATTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGCACTGGAGATTGGATTGAAAATACTGAGTGGC
ATCGGATTGTGGCTCACAACCGCCTAGGTGAAATTGCCTGTCAATTTCTCAAAAAAGGTTCAAAAGTTTATATCGAAGGC
TCATTACATACCCGGAAATGGACTGACCAAAATAATCAAGAACGTTACGTAACTGAAGTTAGAGCCATTACATTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
55.455 |
94.017 |
0.521 |
| ssb | Vibrio cholerae strain A1552 |
54.545 |
84.615 |
0.462 |
| ssb | Neisseria gonorrhoeae MS11 |
42.857 |
89.744 |
0.385 |
| ssb | Neisseria meningitidis MC58 |
42.857 |
89.744 |
0.385 |