Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   CSC59_RS01920 Genome accession   NZ_CP030326
Coordinates   370939..371409 (+) Length   156 a.a.
NCBI ID   WP_000934759.1    Uniprot ID   A0A2I7Y8V1
Organism   Staphylococcus aureus strain AR_474     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 360595..402858 370939..371409 within 0


Gene organization within MGE regions


Location: 360595..402858
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CSC59_RS01830 (CSC59_0067) - 360595..361800 (-) 1206 WP_000264186.1 tyrosine-type recombinase/integrase -
  CSC59_RS01835 (CSC59_0068) - 361911..362090 (+) 180 WP_000337827.1 hypothetical protein -
  CSC59_RS01840 (CSC59_0069) - 362216..362707 (-) 492 WP_001077638.1 hypothetical protein -
  CSC59_RS01845 (CSC59_0070) - 362728..363189 (-) 462 WP_000525016.1 hypothetical protein -
  CSC59_RS01850 (CSC59_0071) - 363202..363525 (-) 324 WP_001260487.1 helix-turn-helix transcriptional regulator -
  CSC59_RS01855 (CSC59_0072) - 363689..363937 (+) 249 WP_000272858.1 helix-turn-helix transcriptional regulator -
  CSC59_RS15530 (CSC59_0073) - 363952..364113 (+) 162 WP_001153175.1 hypothetical protein -
  CSC59_RS01860 (CSC59_0074) - 364106..364342 (-) 237 WP_000856472.1 hypothetical protein -
  CSC59_RS01865 (CSC59_0075) - 364793..364978 (+) 186 WP_000933365.1 helix-turn-helix transcriptional regulator -
  CSC59_RS01870 (CSC59_0076) - 364980..365732 (+) 753 WP_001148634.1 phage antirepressor KilAC domain-containing protein -
  CSC59_RS15600 - 365748..365846 (+) 99 Protein_322 hypothetical protein -
  CSC59_RS01880 (CSC59_0078) - 365996..366259 (+) 264 WP_001124198.1 helix-turn-helix domain-containing protein -
  CSC59_RS01885 - 366271..366432 (+) 162 WP_000066020.1 DUF1270 domain-containing protein -
  CSC59_RS01890 (CSC59_0079) - 366527..366829 (+) 303 WP_000165371.1 DUF2482 family protein -
  CSC59_RS01895 (CSC59_0080) - 366834..367094 (+) 261 WP_000291510.1 DUF1108 family protein -
  CSC59_RS01900 (CSC59_0081) - 367103..367366 (+) 264 WP_001205732.1 hypothetical protein -
  CSC59_RS01905 (CSC59_0082) - 367375..369318 (+) 1944 WP_000700554.1 AAA family ATPase -
  CSC59_RS01910 (CSC59_0083) - 369320..370240 (+) 921 WP_000180599.1 recombinase RecT -
  CSC59_RS01915 (CSC59_0084) - 370321..370938 (+) 618 WP_064135358.1 MBL fold metallo-hydrolase -
  CSC59_RS01920 (CSC59_0085) ssbA 370939..371409 (+) 471 WP_000934759.1 single-stranded DNA-binding protein Machinery gene
  CSC59_RS01925 (CSC59_0086) - 371439..372332 (+) 894 WP_000148333.1 DnaD domain-containing protein -
  CSC59_RS01930 (CSC59_0087) - 372339..372557 (+) 219 WP_000338528.1 hypothetical protein -
  CSC59_RS01935 (CSC59_0088) - 372566..372970 (+) 405 WP_000401969.1 RusA family crossover junction endodeoxyribonuclease -
  CSC59_RS01940 (CSC59_0089) - 372983..373351 (+) 369 WP_000101282.1 SA1788 family PVL leukocidin-associated protein -
  CSC59_RS01945 (CSC59_0090) - 373355..373597 (+) 243 WP_000132210.1 SAV1978 family virulence-associated passenger protein -
  CSC59_RS01950 (CSC59_0091) - 373611..373817 (+) 207 WP_000693995.1 hypothetical protein -
  CSC59_RS01955 (CSC59_0092) - 373820..374221 (+) 402 WP_000695762.1 hypothetical protein -
  CSC59_RS01960 (CSC59_0093) - 374218..374565 (+) 348 WP_000979209.1 YopX family protein -
  CSC59_RS01965 (CSC59_0094) - 374562..374870 (+) 309 WP_000144711.1 hypothetical protein -
  CSC59_RS01970 (CSC59_0095) - 374863..375111 (+) 249 WP_001065026.1 DUF1024 family protein -
  CSC59_RS01975 (CSC59_0096) - 375104..375640 (+) 537 WP_000185682.1 dUTPase -
  CSC59_RS01980 (CSC59_0097) - 375677..375913 (+) 237 WP_000195831.1 DUF1381 domain-containing protein -
  CSC59_RS01985 (CSC59_0098) - 375938..376174 (+) 237 WP_000483479.1 hypothetical protein -
  CSC59_RS01990 (CSC59_0099) - 376164..376553 (+) 390 WP_001580341.1 hypothetical protein -
  CSC59_RS01995 (CSC59_0100) - 376550..376723 (+) 174 WP_000595257.1 transcriptional activator RinB -
  CSC59_RS02000 (CSC59_0101) - 376724..377089 (+) 366 WP_000989954.1 hypothetical protein -
  CSC59_RS02005 (CSC59_0102) - 377090..377236 (+) 147 WP_000989960.1 hypothetical protein -
  CSC59_RS02010 (CSC59_0103) - 377260..377682 (+) 423 WP_000162702.1 RinA family phage transcriptional activator -
  CSC59_RS15535 (CSC59_0104) - 378010..378504 (+) 495 WP_000594082.1 terminase small subunit -
  CSC59_RS02020 (CSC59_0105) - 378497..379705 (+) 1209 WP_000606640.1 PBSX family phage terminase large subunit -
  CSC59_RS02025 (CSC59_0106) - 379719..381137 (+) 1419 WP_000283553.1 phage portal protein -
  CSC59_RS02030 (CSC59_0107) - 381076..382056 (+) 981 WP_001795666.1 phage head morphogenesis protein -
  CSC59_RS02035 (CSC59_0108) - 382154..382750 (+) 597 WP_000366932.1 phage scaffolding protein -
  CSC59_RS02040 (CSC59_0109) - 382771..383595 (+) 825 WP_001135558.1 N4-gp56 family major capsid protein -
  CSC59_RS02045 (CSC59_0110) - 383612..383938 (+) 327 WP_000278799.1 Rho termination factor N-terminal domain-containing protein -
  CSC59_RS02050 (CSC59_0111) - 383938..384252 (+) 315 WP_000338935.1 phage head-tail connector protein -
  CSC59_RS02055 (CSC59_0112) - 384245..384580 (+) 336 WP_000482986.1 phage head closure protein -
  CSC59_RS02060 (CSC59_0113) - 384567..384980 (+) 414 WP_001151335.1 HK97-gp10 family putative phage morphogenesis protein -
  CSC59_RS02065 (CSC59_0114) - 384993..385430 (+) 438 WP_000270197.1 DUF3168 domain-containing protein -
  CSC59_RS02070 (CSC59_0115) - 385417..385977 (+) 561 WP_000046067.1 hypothetical protein -
  CSC59_RS02075 (CSC59_0116) - 386039..386533 (+) 495 WP_000141082.1 tail assembly chaperone -
  CSC59_RS02080 (CSC59_0117) - 386554..386895 (+) 342 WP_001580347.1 hypothetical protein -
  CSC59_RS02085 (CSC59_0118) - 386898..389867 (+) 2970 WP_000414235.1 terminase -
  CSC59_RS02090 (CSC59_0119) - 389882..390817 (+) 936 WP_000560196.1 phage tail domain-containing protein -
  CSC59_RS02095 (CSC59_0120) - 390828..392714 (+) 1887 WP_001144708.1 SGNH/GDSL hydrolase family protein -
  CSC59_RS02100 (CSC59_0121) - 392727..394625 (+) 1899 WP_000323256.1 hypothetical protein -
  CSC59_RS02105 (CSC59_0122) - 394625..396448 (+) 1824 WP_000259638.1 phage baseplate upper protein -
  CSC59_RS02110 (CSC59_0123) - 396448..396825 (+) 378 WP_000705893.1 DUF2977 domain-containing protein -
  CSC59_RS02115 (CSC59_0124) - 396829..397002 (+) 174 WP_001790193.1 XkdX family protein -
  CSC59_RS02120 (CSC59_0125) - 397043..397342 (+) 300 WP_000466769.1 DUF2951 domain-containing protein -
  CSC59_RS02125 (CSC59_0126) - 397479..399353 (+) 1875 WP_000524044.1 glucosaminidase domain-containing protein -
  CSC59_RS02130 (CSC59_0127) - 399366..400538 (+) 1173 WP_000276655.1 BppU family phage baseplate upper protein -
  CSC59_RS02135 (CSC59_0128) - 400544..400939 (+) 396 WP_000398864.1 hypothetical protein -
  CSC59_RS02140 (CSC59_0129) - 400995..401432 (+) 438 WP_000354129.1 phage holin -
  CSC59_RS02145 (CSC59_0130) - 401413..402858 (+) 1446 WP_001148113.1 SH3 domain-containing protein -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17641.52 Da        Isoelectric Point: 5.2672

>NTDB_id=300823 CSC59_RS01920 WP_000934759.1 370939..371409(+) (ssbA) [Staphylococcus aureus strain AR_474]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=300823 CSC59_RS01920 WP_000934759.1 370939..371409(+) (ssbA) [Staphylococcus aureus strain AR_474]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A2I7Y8V1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.932

100

0.635

  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.551

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365


Multiple sequence alignment