Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | DL800_RS19815 | Genome accession | NZ_CP029692 |
| Coordinates | 3335125..3335637 (+) | Length | 170 a.a. |
| NCBI ID | WP_000532424.1 | Uniprot ID | - |
| Organism | Escherichia coli strain SD134209 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 3301513..3360661 | 3335125..3335637 | within | 0 |
| IScluster/Tn | 3333718..3334592 | 3335125..3335637 | flank | 533 |
Gene organization within MGE regions
Location: 3301513..3360661
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DL800_RS19590 (DL800_19590) | - | 3301513..3301782 (-) | 270 | WP_001023452.1 | phage tail fiber C-terminal domain-containing protein | - |
| DL800_RS19595 (DL800_19595) | - | 3301784..3303106 (-) | 1323 | WP_000279058.1 | prophage tail fiber N-terminal domain-containing protein | - |
| DL800_RS19600 (DL800_19600) | - | 3303171..3303770 (-) | 600 | WP_001230455.1 | Ail/Lom family outer membrane beta-barrel protein | - |
| DL800_RS19605 (DL800_19605) | - | 3303838..3307314 (-) | 3477 | WP_000514851.1 | host specificity protein J | - |
| DL800_RS19610 (DL800_19610) | - | 3307561..3308142 (-) | 582 | WP_001089947.1 | tail assembly protein | - |
| DL800_RS19615 (DL800_19615) | - | 3308139..3308882 (-) | 744 | WP_001369128.1 | C40 family peptidase | - |
| DL800_RS19620 (DL800_19620) | - | 3308888..3309586 (-) | 699 | WP_001152113.1 | phage minor tail protein L | - |
| DL800_RS19625 (DL800_19625) | - | 3309586..3309915 (-) | 330 | WP_000847298.1 | phage tail protein | - |
| DL800_RS19630 (DL800_19630) | - | 3309912..3312557 (-) | 2646 | WP_000918243.1 | phage tail tape measure protein | - |
| DL800_RS19635 (DL800_19635) | - | 3312607..3312909 (-) | 303 | Protein_3338 | phage tail assembly protein T | - |
| DL800_RS19640 (DL800_19640) | - | 3312936..3313358 (-) | 423 | WP_000479043.1 | phage minor tail protein G | - |
| DL800_RS19645 (DL800_19645) | - | 3313372..3314124 (-) | 753 | WP_000235090.1 | Ig domain-containing protein | - |
| DL800_RS19650 (DL800_19650) | gpU | 3314132..3314530 (-) | 399 | WP_000682716.1 | phage tail terminator protein | - |
| DL800_RS19655 (DL800_19655) | - | 3314543..3315166 (-) | 624 | WP_000974966.1 | phage tail protein | - |
| DL800_RS19660 (DL800_19660) | - | 3315169..3315450 (-) | 282 | WP_001281350.1 | DNA breaking-rejoining protein | - |
| DL800_RS19665 (DL800_19665) | - | 3315443..3315769 (-) | 327 | WP_001097065.1 | capsid cement protein | - |
| DL800_RS19670 (DL800_19670) | - | 3315857..3317881 (-) | 2025 | WP_001114424.1 | ClpP-like prohead protease/major capsid protein fusion protein | - |
| DL800_RS19675 (DL800_19675) | - | 3317826..3319328 (-) | 1503 | WP_000974564.1 | phage portal protein | - |
| DL800_RS19680 (DL800_19680) | - | 3319328..3319540 (-) | 213 | WP_000102413.1 | hypothetical protein | - |
| DL800_RS19685 (DL800_19685) | - | 3319537..3321660 (-) | 2124 | WP_001077625.1 | phage terminase large subunit family protein | - |
| DL800_RS19690 (DL800_19690) | - | 3321657..3322133 (-) | 477 | WP_000373407.1 | DUF1441 family protein | - |
| DL800_RS30680 | - | 3322608..3322793 (-) | 186 | WP_012816791.1 | Rz1 family lipoprotein | - |
| DL800_RS19700 (DL800_19700) | - | 3323312..3323392 (-) | 81 | Protein_3351 | lysozyme | - |
| DL800_RS19705 (DL800_19705) | stxB1a | 3323797..3324066 (-) | 270 | WP_000752026.1 | Shiga toxin Stx1a subunit B | - |
| DL800_RS19710 (DL800_19710) | stxA1a | 3324076..3325023 (-) | 948 | WP_000691354.1 | Shiga toxin Stx1a subunit A | - |
| DL800_RS19725 (DL800_19725) | - | 3325530..3325964 (-) | 435 | WP_001204849.1 | antiterminator Q family protein | - |
| DL800_RS19730 (DL800_19730) | - | 3325957..3326151 (-) | 195 | WP_000144764.1 | phage NinH family protein | - |
| DL800_RS19735 (DL800_19735) | - | 3326148..3326753 (-) | 606 | WP_001108006.1 | recombination protein NinG | - |
| DL800_RS19740 (DL800_19740) | - | 3326753..3327476 (-) | 724 | Protein_3357 | phage antirepressor KilAC domain-containing protein | - |
| DL800_RS19745 (DL800_19745) | - | 3327551..3328255 (-) | 705 | WP_000211413.1 | phage antirepressor Ant | - |
| DL800_RS19755 (DL800_19755) | - | 3328530..3328712 (-) | 183 | WP_001254256.1 | NinE family protein | - |
| DL800_RS19760 (DL800_19760) | - | 3328709..3329236 (-) | 528 | WP_000153268.1 | phage N-6-adenine-methyltransferase | - |
| DL800_RS19765 (DL800_19765) | - | 3329233..3329679 (-) | 447 | WP_001303571.1 | recombination protein NinB | - |
| DL800_RS30690 | - | 3329636..3329872 (-) | 237 | WP_001449504.1 | Lar family restriction alleviation protein | - |
| DL800_RS30695 | - | 3329883..3330098 (-) | 216 | WP_000103678.1 | hypothetical protein | - |
| DL800_RS19775 (DL800_19775) | - | 3330231..3330509 (-) | 279 | WP_001000130.1 | hypothetical protein | - |
| DL800_RS19780 (DL800_19780) | - | 3330579..3330848 (-) | 270 | WP_001036037.1 | hypothetical protein | - |
| DL800_RS19785 (DL800_19785) | - | 3330848..3332284 (-) | 1437 | WP_000131492.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| DL800_RS19790 (DL800_19790) | - | 3332274..3333173 (-) | 900 | WP_000065668.1 | hypothetical protein | - |
| DL800_RS19795 (DL800_19795) | - | 3333166..3333312 (-) | 147 | WP_000166207.1 | DUF2740 family protein | - |
| DL800_RS19800 (DL800_19800) | - | 3333347..3333625 (-) | 279 | WP_001177653.1 | lambda phage CII family protein | - |
| DL800_RS19805 (DL800_19805) | - | 3333718..3334544 (+) | 827 | Protein_3370 | IS3-like element IS1203 family transposase | - |
| DL800_RS19810 (DL800_19810) | - | 3334549..3335124 (+) | 576 | Protein_3371 | Rad52/Rad22 family DNA repair protein | - |
| DL800_RS19815 (DL800_19815) | ssb | 3335125..3335637 (+) | 513 | WP_000532424.1 | single-stranded DNA-binding protein | Machinery gene |
| DL800_RS19820 (DL800_19820) | - | 3335651..3335944 (+) | 294 | WP_001111331.1 | phage anti-RecBCD protein | - |
| DL800_RS19825 (DL800_19825) | - | 3335955..3336122 (+) | 168 | WP_001214463.1 | DUF2737 family protein | - |
| DL800_RS19830 (DL800_19830) | - | 3336119..3336553 (+) | 435 | Protein_3375 | ead/Ea22-like family protein | - |
| DL800_RS30990 | - | 3336720..3336898 (+) | 179 | Protein_3376 | hypothetical protein | - |
| DL800_RS19835 (DL800_19835) | - | 3337031..3337999 (+) | 969 | Protein_3377 | tyrosine-type recombinase/integrase | - |
| DL800_RS19840 (DL800_19840) | - | 3338038..3338454 (+) | 417 | WP_000448925.1 | hypothetical protein | - |
| DL800_RS19845 (DL800_19845) | - | 3338527..3340275 (-) | 1749 | WP_000214990.1 | response regulator receiver domain | - |
| DL800_RS19850 (DL800_19850) | - | 3340277..3341995 (-) | 1719 | WP_001426837.1 | ATP-binding protein | - |
| DL800_RS19855 (DL800_19855) | - | 3342120..3343220 (+) | 1101 | Protein_3381 | alpha amylase C-terminal domain-containing protein | - |
| DL800_RS19860 (DL800_19860) | glaH | 3343556..3344533 (+) | 978 | WP_000993087.1 | glutarate dioxygenase GlaH | - |
| DL800_RS19865 (DL800_19865) | lhgO | 3344553..3345821 (+) | 1269 | WP_000271938.1 | L-2-hydroxyglutarate oxidase | - |
| DL800_RS19870 (DL800_19870) | gabD | 3345844..3347292 (+) | 1449 | WP_000772858.1 | NADP-dependent succinate-semialdehyde dehydrogenase | - |
| DL800_RS19875 (DL800_19875) | gabT | 3347306..3348586 (+) | 1281 | WP_001087606.1 | 4-aminobutyrate--2-oxoglutarate transaminase | - |
| DL800_RS19880 (DL800_19880) | gabP | 3348897..3350297 (+) | 1401 | WP_001344737.1 | GABA permease | - |
| DL800_RS19885 (DL800_19885) | csiR | 3350318..3350980 (+) | 663 | WP_000156820.1 | DNA-binding transcriptional regulator CsiR | - |
| DL800_RS19890 (DL800_19890) | kbp | 3350981..3351430 (-) | 450 | WP_000522424.1 | potassium binding protein Kbp | - |
| DL800_RS19895 (DL800_19895) | yqaE | 3351514..3351672 (-) | 159 | WP_000508177.1 | YqaE/Pmp3 family membrane protein | - |
| DL800_RS19900 (DL800_19900) | ygaV | 3351855..3352154 (+) | 300 | WP_000137280.1 | metalloregulator ArsR/SmtB family transcription factor | - |
| DL800_RS19905 (DL800_19905) | ygaP | 3352164..3352688 (+) | 525 | WP_001229468.1 | thiosulfate sulfurtransferase YgaP | - |
| DL800_RS19910 (DL800_19910) | stpA | 3352735..3353139 (-) | 405 | WP_000115383.1 | DNA-binding protein StpA | - |
| DL800_RS19915 (DL800_19915) | alaE | 3353807..3354256 (+) | 450 | WP_000492649.1 | L-alanine exporter AlaE | - |
| DL800_RS19920 (DL800_19920) | ygaC | 3354293..3354637 (-) | 345 | WP_000281320.1 | DUF2002 family protein | - |
| DL800_RS19925 (DL800_19925) | ygaM | 3354789..3355118 (+) | 330 | WP_001295174.1 | DUF883 domain-containing protein | - |
| DL800_RS19930 (DL800_19930) | nrdH | 3355366..3355611 (+) | 246 | WP_001223219.1 | glutaredoxin-like protein NrdH | - |
| DL800_RS19935 (DL800_19935) | nrdI | 3355608..3356018 (+) | 411 | WP_000080947.1 | class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI | - |
| DL800_RS19940 (DL800_19940) | nrdE | 3355991..3358135 (+) | 2145 | WP_000246506.1 | class 1b ribonucleoside-diphosphate reductase subunit alpha | - |
| DL800_RS19945 (DL800_19945) | nrdF | 3358145..3359104 (+) | 960 | WP_000777939.1 | class 1b ribonucleoside-diphosphate reductase subunit beta | - |
| DL800_RS19950 (DL800_19950) | proV | 3359459..3360661 (+) | 1203 | WP_000985494.1 | glycine betaine/L-proline ABC transporter ATP-binding protein ProV | - |
Sequence
Protein
Download Length: 170 a.a. Molecular weight: 19066.27 Da Isoelectric Point: 9.4173
>NTDB_id=295352 DL800_RS19815 WP_000532424.1 3335125..3335637(+) (ssb) [Escherichia coli strain SD134209]
MGRGVNRVIIIGRLGQDPEVRYSPSGTAFANLTVATSEQWRDKKTGEQKEQTEWHRVVMSGKLAEIASEYLRKGSEVYLE
GKLRTRKWQDQSGQDRFTTEVIVGVGGAMQMLGGKQGSNEQSSPQRNNGQQQRQQSQQHGNYGEPPMNFDDEIPFAPVTL
PFPRHAIHAI
MGRGVNRVIIIGRLGQDPEVRYSPSGTAFANLTVATSEQWRDKKTGEQKEQTEWHRVVMSGKLAEIASEYLRKGSEVYLE
GKLRTRKWQDQSGQDRFTTEVIVGVGGAMQMLGGKQGSNEQSSPQRNNGQQQRQQSQQHGNYGEPPMNFDDEIPFAPVTL
PFPRHAIHAI
Nucleotide
Download Length: 513 bp
>NTDB_id=295352 DL800_RS19815 WP_000532424.1 3335125..3335637(+) (ssb) [Escherichia coli strain SD134209]
ATGGGACGTGGAGTTAATCGCGTAATCATTATCGGTAGATTAGGCCAAGATCCTGAGGTGCGCTATTCACCATCAGGAAC
GGCATTTGCAAACCTTACAGTTGCTACGTCAGAGCAATGGCGTGATAAGAAAACTGGAGAGCAAAAGGAGCAGACGGAGT
GGCACCGCGTGGTAATGAGCGGAAAACTGGCAGAAATTGCCAGCGAATATCTGCGAAAAGGCTCTGAGGTTTATCTTGAA
GGTAAATTGCGGACAAGAAAATGGCAGGATCAAAGCGGACAGGATAGGTTCACTACAGAAGTTATCGTGGGCGTTGGTGG
AGCCATGCAAATGCTTGGTGGCAAGCAAGGAAGCAATGAACAGTCTTCACCTCAGCGAAATAACGGCCAGCAACAAAGAC
AGCAATCTCAGCAGCATGGGAATTACGGCGAACCACCTATGAACTTCGACGATGAAATCCCCTTTGCACCAGTAACTCTC
CCCTTCCCTCGTCACGCTATTCACGCAATTTAA
ATGGGACGTGGAGTTAATCGCGTAATCATTATCGGTAGATTAGGCCAAGATCCTGAGGTGCGCTATTCACCATCAGGAAC
GGCATTTGCAAACCTTACAGTTGCTACGTCAGAGCAATGGCGTGATAAGAAAACTGGAGAGCAAAAGGAGCAGACGGAGT
GGCACCGCGTGGTAATGAGCGGAAAACTGGCAGAAATTGCCAGCGAATATCTGCGAAAAGGCTCTGAGGTTTATCTTGAA
GGTAAATTGCGGACAAGAAAATGGCAGGATCAAAGCGGACAGGATAGGTTCACTACAGAAGTTATCGTGGGCGTTGGTGG
AGCCATGCAAATGCTTGGTGGCAAGCAAGGAAGCAATGAACAGTCTTCACCTCAGCGAAATAACGGCCAGCAACAAAGAC
AGCAATCTCAGCAGCATGGGAATTACGGCGAACCACCTATGAACTTCGACGATGAAATCCCCTTTGCACCAGTAACTCTC
CCCTTCCCTCGTCACGCTATTCACGCAATTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
59.195 |
100 |
0.606 |
| ssb | Glaesserella parasuis strain SC1401 |
49.171 |
100 |
0.524 |
| ssb | Neisseria meningitidis MC58 |
43.452 |
98.824 |
0.429 |
| ssb | Neisseria gonorrhoeae MS11 |
42.424 |
97.059 |
0.412 |