Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   EQZ01_RS12760 Genome accession   NZ_CP035231
Coordinates   2451165..2451338 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain SRCM103571     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2446165..2456338
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQZ01_RS12745 (EQZ01_12745) gcvT 2446964..2448052 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  EQZ01_RS12750 (EQZ01_12750) hepAA 2448494..2450167 (+) 1674 WP_124058586.1 SNF2-related protein -
  EQZ01_RS12755 (EQZ01_12755) yqhG 2450188..2450982 (+) 795 WP_003230200.1 YqhG family protein -
  EQZ01_RS12760 (EQZ01_12760) sinI 2451165..2451338 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  EQZ01_RS12765 (EQZ01_12765) sinR 2451372..2451707 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  EQZ01_RS12770 (EQZ01_12770) tasA 2451800..2452585 (-) 786 WP_128738018.1 biofilm matrix protein TasA -
  EQZ01_RS12775 (EQZ01_12775) sipW 2452649..2453221 (-) 573 WP_128738626.1 signal peptidase I SipW -
  EQZ01_RS12780 (EQZ01_12780) tapA 2453205..2453966 (-) 762 WP_101169542.1 amyloid fiber anchoring/assembly protein TapA -
  EQZ01_RS12785 (EQZ01_12785) yqzG 2454239..2454565 (+) 327 WP_024573388.1 YqzG/YhdC family protein -
  EQZ01_RS12790 (EQZ01_12790) spoIITA 2454607..2454786 (-) 180 WP_014480252.1 YqzE family protein -
  EQZ01_RS12795 (EQZ01_12795) comGG 2454857..2455231 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  EQZ01_RS12800 (EQZ01_12800) comGF 2455232..2455615 (-) 384 WP_128738019.1 ComG operon protein ComGF Machinery gene
  EQZ01_RS12805 (EQZ01_12805) comGE 2455641..2455988 (-) 348 WP_128738020.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=294697 EQZ01_RS12760 WP_003230187.1 2451165..2451338(+) (sinI) [Bacillus subtilis strain SRCM103571]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=294697 EQZ01_RS12760 WP_003230187.1 2451165..2451338(+) (sinI) [Bacillus subtilis strain SRCM103571]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1