Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   EQZ01_RS12800 Genome accession   NZ_CP035231
Coordinates   2455232..2455615 (-) Length   127 a.a.
NCBI ID   WP_128738019.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM103571     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2450232..2460615
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQZ01_RS12760 (EQZ01_12760) sinI 2451165..2451338 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  EQZ01_RS12765 (EQZ01_12765) sinR 2451372..2451707 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  EQZ01_RS12770 (EQZ01_12770) tasA 2451800..2452585 (-) 786 WP_128738018.1 biofilm matrix protein TasA -
  EQZ01_RS12775 (EQZ01_12775) sipW 2452649..2453221 (-) 573 WP_128738626.1 signal peptidase I SipW -
  EQZ01_RS12780 (EQZ01_12780) tapA 2453205..2453966 (-) 762 WP_101169542.1 amyloid fiber anchoring/assembly protein TapA -
  EQZ01_RS12785 (EQZ01_12785) yqzG 2454239..2454565 (+) 327 WP_024573388.1 YqzG/YhdC family protein -
  EQZ01_RS12790 (EQZ01_12790) spoIITA 2454607..2454786 (-) 180 WP_014480252.1 YqzE family protein -
  EQZ01_RS12795 (EQZ01_12795) comGG 2454857..2455231 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  EQZ01_RS12800 (EQZ01_12800) comGF 2455232..2455615 (-) 384 WP_128738019.1 ComG operon protein ComGF Machinery gene
  EQZ01_RS12805 (EQZ01_12805) comGE 2455641..2455988 (-) 348 WP_128738020.1 ComG operon protein 5 Machinery gene
  EQZ01_RS12810 (EQZ01_12810) comGD 2455972..2456403 (-) 432 WP_024573390.1 comG operon protein ComGD Machinery gene
  EQZ01_RS12815 (EQZ01_12815) comGC 2456393..2456689 (-) 297 WP_024573391.1 comG operon protein ComGC Machinery gene
  EQZ01_RS12820 (EQZ01_12820) comGB 2456703..2457740 (-) 1038 WP_128738021.1 comG operon protein ComGB Machinery gene
  EQZ01_RS12825 (EQZ01_12825) comGA 2457727..2458797 (-) 1071 WP_128738022.1 competence protein ComGA Machinery gene
  EQZ01_RS22000 (EQZ01_12830) - 2459008..2459133 (-) 126 WP_003230155.1 hypothetical protein -
  EQZ01_RS12835 (EQZ01_12835) corA 2459199..2460152 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14354.51 Da        Isoelectric Point: 6.3242

>NTDB_id=294700 EQZ01_RS12800 WP_128738019.1 2455232..2455615(-) (comGF) [Bacillus subtilis strain SRCM103571]
MLISGSLAAIFHLFLSRQQEYDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADIKNGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=294700 EQZ01_RS12800 WP_128738019.1 2455232..2455615(-) (comGF) [Bacillus subtilis strain SRCM103571]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAATATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTAAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

96.85

100

0.969


Multiple sequence alignment