Detailed information
Overview
| Name | comYF | Type | Machinery gene |
| Locus tag | DLJ52_RS00915 | Genome accession | NZ_CP029559 |
| Coordinates | 155705..156142 (+) | Length | 145 a.a. |
| NCBI ID | WP_019781940.1 | Uniprot ID | - |
| Organism | Streptococcus sobrinus strain NIDR 6715-15 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 125475..170654 | 155705..156142 | within | 0 |
Gene organization within MGE regions
Location: 125475..170654
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DLJ52_RS00780 (DLJ52_00780) | rpoC | 128732..132370 (+) | 3639 | WP_109982367.1 | DNA-directed RNA polymerase subunit beta' | - |
| DLJ52_RS00785 (DLJ52_00785) | - | 132664..134328 (+) | 1665 | WP_021673621.1 | peptide ABC transporter substrate-binding protein | - |
| DLJ52_RS00790 (DLJ52_00790) | - | 134433..135347 (+) | 915 | WP_019771159.1 | ABC transporter permease | - |
| DLJ52_RS00795 (DLJ52_00795) | - | 135359..136390 (+) | 1032 | WP_109982368.1 | ABC transporter permease | - |
| DLJ52_RS00800 (DLJ52_00800) | oppD | 136401..137450 (+) | 1050 | WP_019771160.1 | ABC transporter ATP-binding protein | Regulator |
| DLJ52_RS00805 (DLJ52_00805) | amiF | 137447..138370 (+) | 924 | WP_002999065.1 | ABC transporter ATP-binding protein | Regulator |
| DLJ52_RS00810 (DLJ52_00810) | - | 138607..140292 (-) | 1686 | WP_109982369.1 | MFS transporter | - |
| DLJ52_RS00815 (DLJ52_00815) | - | 140424..140945 (+) | 522 | WP_019781803.1 | PadR family transcriptional regulator | - |
| DLJ52_RS00820 (DLJ52_00820) | - | 140958..141266 (+) | 309 | WP_019777335.1 | LlsX family protein | - |
| DLJ52_RS00830 (DLJ52_00830) | - | 141626..142192 (+) | 567 | WP_019781805.1 | TMEM175 family protein | - |
| DLJ52_RS10455 | - | 142546..142689 (-) | 144 | WP_002959475.1 | hypothetical protein | - |
| DLJ52_RS00835 (DLJ52_00835) | - | 142679..142969 (-) | 291 | WP_002997623.1 | hypothetical protein | - |
| DLJ52_RS00840 (DLJ52_00840) | - | 143174..143896 (+) | 723 | WP_019776886.1 | ABC transporter ATP-binding protein | - |
| DLJ52_RS00845 (DLJ52_00845) | - | 143901..145047 (+) | 1147 | Protein_127 | ABC transporter permease | - |
| DLJ52_RS00850 (DLJ52_00850) | - | 145271..145891 (+) | 621 | WP_002959483.1 | TetR/AcrR family transcriptional regulator | - |
| DLJ52_RS00855 (DLJ52_00855) | - | 146069..146331 (-) | 263 | Protein_129 | type II toxin-antitoxin system YafQ family toxin | - |
| DLJ52_RS00860 (DLJ52_00860) | - | 146335..146616 (-) | 282 | WP_002959487.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| DLJ52_RS00865 (DLJ52_00865) | - | 146773..147639 (-) | 867 | WP_002959489.1 | LysR family transcriptional regulator | - |
| DLJ52_RS00870 (DLJ52_00870) | - | 147750..148610 (+) | 861 | WP_002959490.1 | aldo/keto reductase | - |
| DLJ52_RS00875 (DLJ52_00875) | - | 148710..149072 (-) | 363 | WP_002959493.1 | class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI | - |
| DLJ52_RS00880 (DLJ52_00880) | - | 149433..151817 (-) | 2385 | WP_019785320.1 | HAD-IC family P-type ATPase | - |
| DLJ52_RS00885 (DLJ52_00885) | - | 152037..152405 (+) | 369 | WP_019781971.1 | DUF1033 family protein | - |
| DLJ52_RS00890 (DLJ52_00890) | comGA/cglA | 152831..153778 (+) | 948 | WP_019777327.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| DLJ52_RS00895 (DLJ52_00895) | comYB | 153702..154745 (+) | 1044 | WP_002959504.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| DLJ52_RS00900 (DLJ52_00900) | comYC | 154742..155068 (+) | 327 | WP_019770073.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| DLJ52_RS00905 (DLJ52_00905) | comYD | 155022..155456 (+) | 435 | WP_254051091.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| DLJ52_RS00910 (DLJ52_00910) | comYE | 155428..155721 (+) | 294 | WP_002959510.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| DLJ52_RS00915 (DLJ52_00915) | comYF | 155705..156142 (+) | 438 | WP_019781940.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| DLJ52_RS00920 (DLJ52_00920) | comGG | 156120..156581 (+) | 462 | WP_019785527.1 | competence type IV pilus minor pilin ComGG | - |
| DLJ52_RS00930 (DLJ52_00930) | - | 156783..157049 (+) | 267 | WP_002959516.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| DLJ52_RS00935 (DLJ52_00935) | - | 157036..157311 (+) | 276 | WP_109982370.1 | helix-turn-helix transcriptional regulator | - |
| DLJ52_RS00940 (DLJ52_00940) | comYH | 157410..158363 (+) | 954 | WP_109990554.1 | class I SAM-dependent methyltransferase | Machinery gene |
| DLJ52_RS00945 (DLJ52_00945) | - | 158426..159622 (+) | 1197 | WP_019771614.1 | acetate kinase | - |
| DLJ52_RS00950 (DLJ52_00950) | - | 160100..161005 (+) | 906 | WP_019769860.1 | LysR family transcriptional regulator | - |
| DLJ52_RS00955 (DLJ52_00955) | - | 161183..161449 (+) | 267 | WP_002959526.1 | ACT domain-containing protein | - |
| DLJ52_RS00960 (DLJ52_00960) | - | 161461..162798 (+) | 1338 | WP_002959528.1 | PFL family protein | - |
| DLJ52_RS00965 (DLJ52_00965) | - | 163037..163336 (-) | 300 | Protein_150 | hypothetical protein | - |
| DLJ52_RS00970 (DLJ52_00970) | - | 163366..164301 (-) | 936 | WP_019773382.1 | IS30 family transposase | - |
| DLJ52_RS00975 (DLJ52_00975) | - | 164492..164923 (-) | 432 | WP_002961167.1 | MarR family transcriptional regulator | - |
| DLJ52_RS00980 (DLJ52_00980) | - | 165062..165763 (+) | 702 | WP_002961168.1 | histidine phosphatase family protein | - |
| DLJ52_RS00985 (DLJ52_00985) | - | 165750..166517 (+) | 768 | WP_002961169.1 | M15 family metallopeptidase | - |
| DLJ52_RS00990 (DLJ52_00990) | - | 166684..167268 (+) | 585 | WP_002961170.1 | glycoside hydrolase family 73 protein | - |
| DLJ52_RS00995 (DLJ52_00995) | hrcA | 167435..168469 (+) | 1035 | WP_002961171.1 | heat-inducible transcriptional repressor HrcA | - |
| DLJ52_RS01000 (DLJ52_01000) | grpE | 168489..169040 (+) | 552 | WP_019790544.1 | nucleotide exchange factor GrpE | - |
| DLJ52_RS10410 | - | 169105..169305 (+) | 201 | WP_162564139.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 145 a.a. Molecular weight: 16261.67 Da Isoelectric Point: 8.2388
>NTDB_id=293509 DLJ52_RS00915 WP_019781940.1 155705..156142(+) (comYF) [Streptococcus sobrinus strain NIDR 6715-15]
MWLKTRIRSFTLLECLVALLVIAGSVMVYQGLTQVLTSNVAYISKNDEEDWLLFCQQLRSELSGTDLDRVADNKLYVKKG
DQPLAFGQSRSDDFRKTNADGRGYQPMLFGLKACTISQTGQTVTISLTLKSGLERTFVYDFAKTS
MWLKTRIRSFTLLECLVALLVIAGSVMVYQGLTQVLTSNVAYISKNDEEDWLLFCQQLRSELSGTDLDRVADNKLYVKKG
DQPLAFGQSRSDDFRKTNADGRGYQPMLFGLKACTISQTGQTVTISLTLKSGLERTFVYDFAKTS
Nucleotide
Download Length: 438 bp
>NTDB_id=293509 DLJ52_RS00915 WP_019781940.1 155705..156142(+) (comYF) [Streptococcus sobrinus strain NIDR 6715-15]
ATGTGGCTAAAAACTAGAATTCGATCCTTCACCCTCTTGGAGTGCTTGGTGGCCCTCTTGGTCATCGCTGGCAGTGTCAT
GGTCTATCAGGGGCTAACCCAGGTTTTGACCAGCAATGTTGCCTACATCAGCAAGAATGATGAGGAGGACTGGCTCCTCT
TTTGTCAGCAGCTTCGCTCAGAGCTATCTGGGACTGACTTGGACCGGGTGGCGGACAATAAACTTTATGTCAAAAAGGGT
GACCAGCCTCTAGCCTTTGGCCAGTCCCGCTCGGATGATTTTCGCAAGACCAATGCTGACGGCCGGGGCTATCAGCCCAT
GCTCTTTGGCCTCAAGGCCTGCACCATCAGCCAGACTGGTCAGACCGTCACTATTTCGCTGACTCTGAAATCAGGCTTAG
AAAGGACCTTTGTCTATGATTTTGCAAAAACGTCTTAG
ATGTGGCTAAAAACTAGAATTCGATCCTTCACCCTCTTGGAGTGCTTGGTGGCCCTCTTGGTCATCGCTGGCAGTGTCAT
GGTCTATCAGGGGCTAACCCAGGTTTTGACCAGCAATGTTGCCTACATCAGCAAGAATGATGAGGAGGACTGGCTCCTCT
TTTGTCAGCAGCTTCGCTCAGAGCTATCTGGGACTGACTTGGACCGGGTGGCGGACAATAAACTTTATGTCAAAAAGGGT
GACCAGCCTCTAGCCTTTGGCCAGTCCCGCTCGGATGATTTTCGCAAGACCAATGCTGACGGCCGGGGCTATCAGCCCAT
GCTCTTTGGCCTCAAGGCCTGCACCATCAGCCAGACTGGTCAGACCGTCACTATTTCGCTGACTCTGAAATCAGGCTTAG
AAAGGACCTTTGTCTATGATTTTGCAAAAACGTCTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comYF | Streptococcus mutans UA140 |
63.309 |
95.862 |
0.607 |
| comYF | Streptococcus mutans UA159 |
62.59 |
95.862 |
0.6 |
| comGF | Lactococcus lactis subsp. cremoris KW2 |
50.35 |
98.621 |
0.497 |
| comGF/cglF | Streptococcus mitis NCTC 12261 |
43.448 |
100 |
0.434 |
| comGF/cglF | Streptococcus pneumoniae Rx1 |
44.928 |
95.172 |
0.428 |
| comGF/cglF | Streptococcus pneumoniae D39 |
44.928 |
95.172 |
0.428 |
| comGF/cglF | Streptococcus pneumoniae R6 |
44.928 |
95.172 |
0.428 |
| comGF/cglF | Streptococcus pneumoniae TIGR4 |
44.928 |
95.172 |
0.428 |
| comGF/cglF | Streptococcus mitis SK321 |
41.379 |
100 |
0.414 |