Detailed information    

insolico Bioinformatically predicted

Overview


Name   comYH   Type   Machinery gene
Locus tag   DLJ52_RS00940 Genome accession   NZ_CP029559
Coordinates   157410..158363 (+) Length   317 a.a.
NCBI ID   WP_109990554.1    Uniprot ID   -
Organism   Streptococcus sobrinus strain NIDR 6715-15     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 125475..170654 157410..158363 within 0


Gene organization within MGE regions


Location: 125475..170654
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DLJ52_RS00780 (DLJ52_00780) rpoC 128732..132370 (+) 3639 WP_109982367.1 DNA-directed RNA polymerase subunit beta' -
  DLJ52_RS00785 (DLJ52_00785) - 132664..134328 (+) 1665 WP_021673621.1 peptide ABC transporter substrate-binding protein -
  DLJ52_RS00790 (DLJ52_00790) - 134433..135347 (+) 915 WP_019771159.1 ABC transporter permease -
  DLJ52_RS00795 (DLJ52_00795) - 135359..136390 (+) 1032 WP_109982368.1 ABC transporter permease -
  DLJ52_RS00800 (DLJ52_00800) oppD 136401..137450 (+) 1050 WP_019771160.1 ABC transporter ATP-binding protein Regulator
  DLJ52_RS00805 (DLJ52_00805) amiF 137447..138370 (+) 924 WP_002999065.1 ABC transporter ATP-binding protein Regulator
  DLJ52_RS00810 (DLJ52_00810) - 138607..140292 (-) 1686 WP_109982369.1 MFS transporter -
  DLJ52_RS00815 (DLJ52_00815) - 140424..140945 (+) 522 WP_019781803.1 PadR family transcriptional regulator -
  DLJ52_RS00820 (DLJ52_00820) - 140958..141266 (+) 309 WP_019777335.1 LlsX family protein -
  DLJ52_RS00830 (DLJ52_00830) - 141626..142192 (+) 567 WP_019781805.1 TMEM175 family protein -
  DLJ52_RS10455 - 142546..142689 (-) 144 WP_002959475.1 hypothetical protein -
  DLJ52_RS00835 (DLJ52_00835) - 142679..142969 (-) 291 WP_002997623.1 hypothetical protein -
  DLJ52_RS00840 (DLJ52_00840) - 143174..143896 (+) 723 WP_019776886.1 ABC transporter ATP-binding protein -
  DLJ52_RS00845 (DLJ52_00845) - 143901..145047 (+) 1147 Protein_127 ABC transporter permease -
  DLJ52_RS00850 (DLJ52_00850) - 145271..145891 (+) 621 WP_002959483.1 TetR/AcrR family transcriptional regulator -
  DLJ52_RS00855 (DLJ52_00855) - 146069..146331 (-) 263 Protein_129 type II toxin-antitoxin system YafQ family toxin -
  DLJ52_RS00860 (DLJ52_00860) - 146335..146616 (-) 282 WP_002959487.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
  DLJ52_RS00865 (DLJ52_00865) - 146773..147639 (-) 867 WP_002959489.1 LysR family transcriptional regulator -
  DLJ52_RS00870 (DLJ52_00870) - 147750..148610 (+) 861 WP_002959490.1 aldo/keto reductase -
  DLJ52_RS00875 (DLJ52_00875) - 148710..149072 (-) 363 WP_002959493.1 class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI -
  DLJ52_RS00880 (DLJ52_00880) - 149433..151817 (-) 2385 WP_019785320.1 HAD-IC family P-type ATPase -
  DLJ52_RS00885 (DLJ52_00885) - 152037..152405 (+) 369 WP_019781971.1 DUF1033 family protein -
  DLJ52_RS00890 (DLJ52_00890) comGA/cglA 152831..153778 (+) 948 WP_019777327.1 competence type IV pilus ATPase ComGA Machinery gene
  DLJ52_RS00895 (DLJ52_00895) comYB 153702..154745 (+) 1044 WP_002959504.1 competence type IV pilus assembly protein ComGB Machinery gene
  DLJ52_RS00900 (DLJ52_00900) comYC 154742..155068 (+) 327 WP_019770073.1 competence type IV pilus major pilin ComGC Machinery gene
  DLJ52_RS00905 (DLJ52_00905) comYD 155022..155456 (+) 435 WP_254051091.1 competence type IV pilus minor pilin ComGD Machinery gene
  DLJ52_RS00910 (DLJ52_00910) comYE 155428..155721 (+) 294 WP_002959510.1 competence type IV pilus minor pilin ComGE Machinery gene
  DLJ52_RS00915 (DLJ52_00915) comYF 155705..156142 (+) 438 WP_019781940.1 competence type IV pilus minor pilin ComGF Machinery gene
  DLJ52_RS00920 (DLJ52_00920) comGG 156120..156581 (+) 462 WP_019785527.1 competence type IV pilus minor pilin ComGG -
  DLJ52_RS00930 (DLJ52_00930) - 156783..157049 (+) 267 WP_002959516.1 type II toxin-antitoxin system RelE/ParE family toxin -
  DLJ52_RS00935 (DLJ52_00935) - 157036..157311 (+) 276 WP_109982370.1 helix-turn-helix transcriptional regulator -
  DLJ52_RS00940 (DLJ52_00940) comYH 157410..158363 (+) 954 WP_109990554.1 class I SAM-dependent methyltransferase Machinery gene
  DLJ52_RS00945 (DLJ52_00945) - 158426..159622 (+) 1197 WP_019771614.1 acetate kinase -
  DLJ52_RS00950 (DLJ52_00950) - 160100..161005 (+) 906 WP_019769860.1 LysR family transcriptional regulator -
  DLJ52_RS00955 (DLJ52_00955) - 161183..161449 (+) 267 WP_002959526.1 ACT domain-containing protein -
  DLJ52_RS00960 (DLJ52_00960) - 161461..162798 (+) 1338 WP_002959528.1 PFL family protein -
  DLJ52_RS00965 (DLJ52_00965) - 163037..163336 (-) 300 Protein_150 hypothetical protein -
  DLJ52_RS00970 (DLJ52_00970) - 163366..164301 (-) 936 WP_019773382.1 IS30 family transposase -
  DLJ52_RS00975 (DLJ52_00975) - 164492..164923 (-) 432 WP_002961167.1 MarR family transcriptional regulator -
  DLJ52_RS00980 (DLJ52_00980) - 165062..165763 (+) 702 WP_002961168.1 histidine phosphatase family protein -
  DLJ52_RS00985 (DLJ52_00985) - 165750..166517 (+) 768 WP_002961169.1 M15 family metallopeptidase -
  DLJ52_RS00990 (DLJ52_00990) - 166684..167268 (+) 585 WP_002961170.1 glycoside hydrolase family 73 protein -
  DLJ52_RS00995 (DLJ52_00995) hrcA 167435..168469 (+) 1035 WP_002961171.1 heat-inducible transcriptional repressor HrcA -
  DLJ52_RS01000 (DLJ52_01000) grpE 168489..169040 (+) 552 WP_019790544.1 nucleotide exchange factor GrpE -
  DLJ52_RS10410 - 169105..169305 (+) 201 WP_162564139.1 hypothetical protein -

Sequence


Protein


Download         Length: 317 a.a.        Molecular weight: 35504.32 Da        Isoelectric Point: 4.1537

>NTDB_id=293510 DLJ52_RS00940 WP_109990554.1 157410..158363(+) (comYH) [Streptococcus sobrinus strain NIDR 6715-15]
MNFETIEKAYELLLENVQLLQNDLKTNSYDALIEQNAIYLDGKTENKTVLANDQALCDLNLSKEEWRRAYQFLFIKLAQS
EPLQANHQFTPDSIGFVLLFLLENLTKEASLDLLEIGSGTGNLAQTLLNNSSKGLNYLGLEVDDLLIDLSASIADVVGSD
ASFVQEDAVRPSLLKESDIIVSDLPVGYYPDDAIASRYQVAAQDDHTYAHHLLMEQSLKYLKANGFAIFLAPVNLLTSPQ
SDLLKAWLKGYADIVAVITLPEELFGNPANAKSIFVLQKQTVQAPEIFVYPLSDLQDRDKLLDFMENFKKWSAEYIL

Nucleotide


Download         Length: 954 bp        

>NTDB_id=293510 DLJ52_RS00940 WP_109990554.1 157410..158363(+) (comYH) [Streptococcus sobrinus strain NIDR 6715-15]
ATGAATTTTGAAACGATTGAAAAAGCTTATGAGCTGCTATTAGAGAATGTTCAGCTCTTGCAAAATGACTTGAAGACCAA
TAGTTACGATGCCTTGATTGAGCAAAATGCTATCTATCTGGATGGCAAAACTGAAAATAAGACGGTTTTGGCCAATGACC
AGGCCTTGTGTGACTTGAATTTGAGCAAGGAAGAGTGGCGGAGGGCCTACCAGTTTCTCTTTATTAAGCTGGCCCAGTCT
GAACCCTTGCAGGCCAACCACCAGTTTACGCCGGATAGTATTGGTTTTGTCCTGCTTTTCTTGCTGGAAAATCTGACCAA
GGAAGCAAGTCTGGACCTTCTGGAGATTGGCTCTGGAACAGGCAATCTAGCTCAAACCCTGCTCAATAACAGCAGTAAAG
GTCTGAATTATCTGGGGCTAGAAGTGGATGATTTGCTGATTGATTTGTCAGCCAGCATCGCTGATGTTGTGGGATCTGAC
GCTAGTTTCGTGCAGGAGGATGCGGTTCGTCCTTCCCTGCTCAAGGAGAGCGACATTATTGTCAGCGATCTTCCCGTTGG
CTATTATCCCGATGATGCTATTGCCAGTCGCTACCAGGTGGCTGCCCAGGATGACCACACCTATGCCCATCACCTGCTTA
TGGAGCAGTCGCTCAAGTACTTGAAGGCCAATGGTTTTGCCATTTTCTTGGCTCCAGTCAATCTTCTGACCAGTCCCCAG
AGTGATCTGCTCAAGGCTTGGCTCAAGGGTTATGCTGACATCGTGGCCGTCATTACCCTACCTGAGGAACTTTTTGGCAA
TCCGGCCAATGCCAAGTCTATCTTTGTCCTGCAGAAGCAGACTGTTCAGGCGCCCGAGATCTTCGTCTATCCGCTGAGTG
ATTTGCAAGACCGAGATAAGCTCTTGGATTTTATGGAAAATTTCAAGAAATGGTCAGCTGAATATATTCTTTGA

Domains


Predicted by InterproScan.

(68-299)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comYH Streptococcus mutans UA159

64.984

100

0.65

  comYH Streptococcus mutans UA140

64.669

100

0.647


Multiple sequence alignment