Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   LPEG9_RS11915 Genome accession   NZ_CP029546
Coordinates   2263477..2263959 (-) Length   160 a.a.
NCBI ID   WP_109990388.1    Uniprot ID   -
Organism   Lacticaseibacillus paracasei strain EG9     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2233602..2279550 2263477..2263959 within 0


Gene organization within MGE regions


Location: 2233602..2279550
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LPEG9_RS11700 (LPEG9_11700) - 2233602..2234651 (-) 1050 WP_109990354.1 N-acetylmuramoyl-L-alanine amidase -
  LPEG9_RS11705 (LPEG9_11705) - 2234651..2234923 (-) 273 WP_109990355.1 holin -
  LPEG9_RS11710 (LPEG9_11710) - 2234913..2235146 (-) 234 WP_109990356.1 hypothetical protein -
  LPEG9_RS11715 (LPEG9_11715) - 2235139..2235516 (-) 378 WP_109990357.1 hypothetical protein -
  LPEG9_RS11720 (LPEG9_11720) - 2235538..2238693 (-) 3156 WP_109990358.1 CotH kinase family protein -
  LPEG9_RS11725 (LPEG9_11725) - 2238662..2240758 (-) 2097 WP_109990359.1 phage tail protein -
  LPEG9_RS11730 (LPEG9_11730) - 2240771..2242036 (-) 1266 WP_109990360.1 phage tail domain-containing protein -
  LPEG9_RS11735 (LPEG9_11735) - 2242040..2245036 (-) 2997 WP_109990361.1 phage tail tape measure protein -
  LPEG9_RS11740 (LPEG9_11740) - 2245036..2245251 (-) 216 WP_225421907.1 hypothetical protein -
  LPEG9_RS11745 (LPEG9_11745) - 2245341..2245781 (-) 441 WP_045136425.1 tail assembly chaperone -
  LPEG9_RS11750 (LPEG9_11750) - 2245845..2246474 (-) 630 WP_109990363.1 phage major tail protein, TP901-1 family -
  LPEG9_RS11755 (LPEG9_11755) - 2246476..2246841 (-) 366 WP_109990364.1 hypothetical protein -
  LPEG9_RS11760 (LPEG9_11760) - 2246838..2247212 (-) 375 WP_109990365.1 HK97-gp10 family putative phage morphogenesis protein -
  LPEG9_RS11770 (LPEG9_11770) - 2247501..2247860 (-) 360 WP_109990367.1 phage head-tail connector protein -
  LPEG9_RS11775 (LPEG9_11775) - 2247860..2248738 (-) 879 WP_109990368.1 hypothetical protein -
  LPEG9_RS11780 (LPEG9_11780) - 2248807..2249727 (-) 921 WP_109990369.1 phage capsid protein -
  LPEG9_RS11785 (LPEG9_11785) - 2249741..2250283 (-) 543 WP_109990370.1 DUF4355 domain-containing protein -
  LPEG9_RS11790 (LPEG9_11790) - 2250435..2250644 (-) 210 WP_162551615.1 ChaB family protein -
  LPEG9_RS11795 (LPEG9_11795) - 2250655..2250888 (-) 234 WP_109990372.1 hypothetical protein -
  LPEG9_RS11800 (LPEG9_11800) - 2250898..2251710 (-) 813 WP_225421908.1 phage head morphogenesis protein -
  LPEG9_RS11805 (LPEG9_11805) - 2251634..2253154 (-) 1521 WP_109990373.1 phage portal protein -
  LPEG9_RS11810 (LPEG9_11810) - 2253156..2254454 (-) 1299 WP_109990374.1 PBSX family phage terminase large subunit -
  LPEG9_RS11815 (LPEG9_11815) - 2254438..2255022 (-) 585 WP_109990375.1 terminase small subunit -
  LPEG9_RS16660 - 2255022..2255159 (-) 138 WP_003566426.1 hypothetical protein -
  LPEG9_RS11820 (LPEG9_11820) - 2255169..2256317 (-) 1149 WP_109990376.1 GcrA family cell cycle regulator -
  LPEG9_RS11825 (LPEG9_11825) - 2256342..2256596 (-) 255 WP_109990377.1 hypothetical protein -
  LPEG9_RS11830 (LPEG9_11830) - 2257276..2257704 (-) 429 WP_003582019.1 hypothetical protein -
  LPEG9_RS11835 (LPEG9_11835) - 2257780..2257998 (-) 219 WP_109990378.1 helix-turn-helix domain-containing protein -
  LPEG9_RS11845 (LPEG9_11845) - 2258076..2258270 (-) 195 WP_109990212.1 hypothetical protein -
  LPEG9_RS11850 (LPEG9_11850) - 2258267..2258713 (-) 447 WP_109990213.1 YopX family protein -
  LPEG9_RS11855 (LPEG9_11855) - 2258710..2259012 (-) 303 WP_109990214.1 hypothetical protein -
  LPEG9_RS16520 - 2259009..2259170 (-) 162 WP_162551596.1 hypothetical protein -
  LPEG9_RS11860 (LPEG9_11860) - 2259173..2259418 (-) 246 WP_109990379.1 hypothetical protein -
  LPEG9_RS11865 (LPEG9_11865) - 2259504..2259692 (-) 189 WP_071252654.1 hypothetical protein -
  LPEG9_RS11870 (LPEG9_11870) - 2259689..2260006 (-) 318 WP_109990380.1 hypothetical protein -
  LPEG9_RS16965 - 2259996..2260124 (-) 129 WP_263854521.1 hypothetical protein -
  LPEG9_RS11875 (LPEG9_11875) - 2260117..2260671 (-) 555 WP_109990381.1 NUMOD4 domain-containing protein -
  LPEG9_RS11880 (LPEG9_11880) - 2260664..2261185 (-) 522 WP_109990382.1 DUF1642 domain-containing protein -
  LPEG9_RS11885 (LPEG9_11885) - 2261182..2261445 (-) 264 WP_109990383.1 hypothetical protein -
  LPEG9_RS11890 (LPEG9_11890) - 2261553..2261918 (-) 366 WP_003607027.1 endodeoxyribonuclease -
  LPEG9_RS11895 (LPEG9_11895) - 2261915..2262169 (-) 255 WP_109990384.1 hypothetical protein -
  LPEG9_RS11900 (LPEG9_11900) - 2262216..2262665 (-) 450 WP_109990385.1 hypothetical protein -
  LPEG9_RS11905 (LPEG9_11905) - 2262662..2262877 (-) 216 WP_109990386.1 helix-turn-helix domain-containing protein -
  LPEG9_RS11910 (LPEG9_11910) - 2262908..2263456 (-) 549 WP_109990387.1 NUMOD4 motif-containing HNH endonuclease -
  LPEG9_RS11915 (LPEG9_11915) ssb 2263477..2263959 (-) 483 WP_109990388.1 single-stranded DNA-binding protein Machinery gene
  LPEG9_RS11920 (LPEG9_11920) - 2263972..2264928 (-) 957 WP_109990389.1 DnaD domain protein -
  LPEG9_RS11925 (LPEG9_11925) - 2264944..2265801 (-) 858 WP_225421909.1 PD-(D/E)XK nuclease-like domain-containing protein -
  LPEG9_RS11930 (LPEG9_11930) - 2265725..2266591 (-) 867 WP_263854522.1 recombinase RecT -
  LPEG9_RS11935 (LPEG9_11935) - 2266588..2267028 (-) 441 WP_049181946.1 hypothetical protein -
  LPEG9_RS11940 (LPEG9_11940) - 2267021..2267272 (-) 252 WP_109990391.1 hypothetical protein -
  LPEG9_RS16970 (LPEG9_11945) - 2267260..2267388 (-) 129 WP_003607017.1 hypothetical protein -
  LPEG9_RS11950 (LPEG9_11950) - 2267391..2267717 (-) 327 WP_003581994.1 hypothetical protein -
  LPEG9_RS11955 (LPEG9_11955) - 2267708..2268181 (-) 474 WP_109990392.1 helix-turn-helix transcriptional regulator -
  LPEG9_RS16665 (LPEG9_11960) - 2268244..2268402 (-) 159 WP_004562013.1 hypothetical protein -
  LPEG9_RS11965 (LPEG9_11965) - 2268399..2268665 (-) 267 WP_109990393.1 helix-turn-helix transcriptional regulator -
  LPEG9_RS11970 (LPEG9_11970) - 2268815..2269240 (+) 426 WP_031546731.1 helix-turn-helix transcriptional regulator -
  LPEG9_RS11975 (LPEG9_11975) - 2269250..2269711 (+) 462 WP_191989241.1 ImmA/IrrE family metallo-endopeptidase -
  LPEG9_RS11980 (LPEG9_11980) - 2269771..2270349 (+) 579 WP_109990394.1 hypothetical protein -
  LPEG9_RS11985 (LPEG9_11985) - 2270443..2271657 (+) 1215 WP_109990395.1 site-specific integrase -
  LPEG9_RS11990 (LPEG9_11990) rplL 2271793..2272161 (-) 369 WP_109990396.1 50S ribosomal protein L7/L12 -
  LPEG9_RS11995 (LPEG9_11995) rplJ 2272202..2272708 (-) 507 WP_003603186.1 50S ribosomal protein L10 -
  LPEG9_RS12000 (LPEG9_12000) - 2273133..2274365 (+) 1233 WP_003567142.1 MFS transporter -
  LPEG9_RS12005 (LPEG9_12005) - 2274423..2275256 (-) 834 WP_162551618.1 hypothetical protein -
  LPEG9_RS12010 (LPEG9_12010) - 2275249..2275767 (-) 519 WP_003661843.1 DUF3278 domain-containing protein -
  LPEG9_RS12015 (LPEG9_12015) - 2276024..2277229 (+) 1206 WP_109990397.1 MFS transporter -
  LPEG9_RS12020 (LPEG9_12020) - 2277300..2278673 (-) 1374 WP_003591597.1 NAD-dependent succinate-semialdehyde dehydrogenase -
  LPEG9_RS12025 (LPEG9_12025) rplA 2278861..2279550 (-) 690 WP_109990398.1 50S ribosomal protein L1 -

Sequence

Protein


Download         Length: 160 a.a.        Molecular weight: 17410.15 Da        Isoelectric Point: 8.0036

>NTDB_id=293417 LPEG9_RS11915 WP_109990388.1 2263477..2263959(-) (ssb) [Lacticaseibacillus paracasei strain EG9]
MLNSVSLTGRLTRDVDLRYTQSGTAVGSFTLAVDRKFKSKNGERETDFVNCQIWRKSAENFANFTKKGSLVGVEGHIQTR
TYDNAQGQKVFVTEVIVENFALLESRQASQNSPKSQQTANASAAATTNASQTTPNASRANATDPFANNGQPLDISDDLPF

Nucleotide


Download         Length: 483 bp        

>NTDB_id=293417 LPEG9_RS11915 WP_109990388.1 2263477..2263959(-) (ssb) [Lacticaseibacillus paracasei strain EG9]
TTGCTAAACAGTGTCTCACTAACAGGCCGACTGACAAGAGATGTTGACTTGCGCTACACGCAAAGCGGCACGGCGGTAGG
ATCATTCACACTGGCAGTTGATCGCAAATTCAAGAGCAAAAACGGAGAACGAGAAACTGATTTCGTAAATTGCCAGATCT
GGCGCAAGTCGGCTGAGAACTTTGCAAACTTCACCAAAAAAGGCTCCTTGGTTGGCGTGGAAGGCCATATCCAAACGCGC
ACGTATGATAACGCGCAAGGGCAGAAAGTATTCGTGACCGAGGTAATCGTTGAGAATTTTGCTTTGCTTGAGTCACGACA
GGCGTCTCAGAACAGCCCTAAATCACAGCAAACGGCCAATGCATCAGCAGCAGCGACCACAAACGCGAGTCAAACGACTC
CAAATGCTTCGCGAGCGAATGCCACGGATCCTTTTGCTAATAATGGCCAGCCGCTCGATATTTCTGATGATCTTCCGTTC
TGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-102)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

62.209

100

0.669
  ssbA Bacillus subtilis subsp. subtilis str. 168

50

100

0.538
  ssbB Bacillus subtilis subsp. subtilis str. 168

54.717

66.25

0.363

Multiple sequence alignment