Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   B7L90_RS17070 Genome accession   NZ_CP029473
Coordinates   3378996..3379373 (+) Length   125 a.a.
NCBI ID   WP_014305410.1    Uniprot ID   -
Organism   Bacillus velezensis strain Hx05     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 3373996..3384373
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B7L90_RS17035 (B7L90_11120) - 3374312..3375262 (+) 951 WP_003153082.1 magnesium transporter CorA family protein -
  B7L90_RS17040 (B7L90_11115) comGA 3375454..3376524 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  B7L90_RS17045 (B7L90_11110) comGB 3376511..3377548 (+) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  B7L90_RS17050 (B7L90_11105) comGC 3377595..3377861 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  B7L90_RS17055 (B7L90_11100) comGD 3377851..3378288 (+) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene
  B7L90_RS17060 (B7L90_11095) comGE 3378272..3378586 (+) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  B7L90_RS17065 (B7L90_11090) comGF 3378495..3378995 (+) 501 WP_226565836.1 competence type IV pilus minor pilin ComGF -
  B7L90_RS17070 (B7L90_11085) comGG 3378996..3379373 (+) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  B7L90_RS17075 (B7L90_11080) - 3379430..3379609 (+) 180 WP_003153093.1 YqzE family protein -
  B7L90_RS17080 (B7L90_11075) - 3379649..3379978 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  B7L90_RS17085 (B7L90_11070) tapA 3380237..3380908 (+) 672 WP_025852919.1 amyloid fiber anchoring/assembly protein TapA -
  B7L90_RS17090 (B7L90_11065) - 3380880..3381464 (+) 585 WP_025852917.1 signal peptidase I -
  B7L90_RS17095 (B7L90_11060) - 3381528..3382313 (+) 786 WP_003153102.1 TasA family protein -
  B7L90_RS17100 (B7L90_11055) sinR 3382361..3382696 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  B7L90_RS17105 (B7L90_11050) sinI 3382730..3382903 (-) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  B7L90_RS17110 (B7L90_11045) - 3383080..3383874 (-) 795 WP_014305407.1 YqhG family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14170.14 Da        Isoelectric Point: 9.9592

>NTDB_id=292967 B7L90_RS17070 WP_014305410.1 3378996..3379373(+) (comGG) [Bacillus velezensis strain Hx05]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSDRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=292967 B7L90_RS17070 WP_014305410.1 3378996..3379373(+) (comGG) [Bacillus velezensis strain Hx05]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512

Multiple sequence alignment