Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | B7L90_RS17105 | Genome accession | NZ_CP029473 |
| Coordinates | 3382730..3382903 (-) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain Hx05 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3377730..3387903
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| B7L90_RS17055 (B7L90_11100) | comGD | 3377851..3378288 (+) | 438 | WP_025852922.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| B7L90_RS17060 (B7L90_11095) | comGE | 3378272..3378586 (+) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| B7L90_RS17065 (B7L90_11090) | comGF | 3378495..3378995 (+) | 501 | WP_226565836.1 | competence type IV pilus minor pilin ComGF | - |
| B7L90_RS17070 (B7L90_11085) | comGG | 3378996..3379373 (+) | 378 | WP_014305410.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| B7L90_RS17075 (B7L90_11080) | - | 3379430..3379609 (+) | 180 | WP_003153093.1 | YqzE family protein | - |
| B7L90_RS17080 (B7L90_11075) | - | 3379649..3379978 (-) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| B7L90_RS17085 (B7L90_11070) | tapA | 3380237..3380908 (+) | 672 | WP_025852919.1 | amyloid fiber anchoring/assembly protein TapA | - |
| B7L90_RS17090 (B7L90_11065) | - | 3380880..3381464 (+) | 585 | WP_025852917.1 | signal peptidase I | - |
| B7L90_RS17095 (B7L90_11060) | - | 3381528..3382313 (+) | 786 | WP_003153102.1 | TasA family protein | - |
| B7L90_RS17100 (B7L90_11055) | sinR | 3382361..3382696 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| B7L90_RS17105 (B7L90_11050) | sinI | 3382730..3382903 (-) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| B7L90_RS17110 (B7L90_11045) | - | 3383080..3383874 (-) | 795 | WP_014305407.1 | YqhG family protein | - |
| B7L90_RS17115 (B7L90_11040) | - | 3383892..3385562 (-) | 1671 | WP_003153107.1 | SNF2-related protein | - |
| B7L90_RS17120 (B7L90_11035) | gcvT | 3385985..3387085 (+) | 1101 | WP_003153108.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=292969 B7L90_RS17105 WP_003153105.1 3382730..3382903(-) (sinI) [Bacillus velezensis strain Hx05]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=292969 B7L90_RS17105 WP_003153105.1 3382730..3382903(-) (sinI) [Bacillus velezensis strain Hx05]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |