Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | DJ572_RS20815 | Genome accession | NZ_CP029461 |
| Coordinates | 4007309..4007827 (-) | Length | 172 a.a. |
| NCBI ID | WP_003219228.1 | Uniprot ID | A0A063XE16 |
| Organism | Bacillus subtilis strain QB61 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 3960715..4007294 | 4007309..4007827 | flank | 15 |
Gene organization within MGE regions
Location: 3960715..4007827
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DJ572_RS20520 (DJ572_20395) | yybO | 3961131..3962441 (+) | 1311 | WP_119900000.1 | MFS transporter | - |
| DJ572_RS20525 (DJ572_20400) | - | 3962602..3963339 (+) | 738 | WP_042976959.1 | MerR family transcriptional regulator | - |
| DJ572_RS20530 (DJ572_20405) | - | 3963377..3964165 (-) | 789 | WP_119900001.1 | hypothetical protein | - |
| DJ572_RS20535 (DJ572_20410) | yybH | 3964233..3964622 (-) | 390 | WP_119900003.1 | nuclear transport factor 2 family protein | - |
| DJ572_RS20540 (DJ572_20415) | yybG | 3964768..3965607 (+) | 840 | WP_119900005.1 | pentapeptide repeat-containing protein | - |
| DJ572_RS20545 (DJ572_20420) | yybF | 3965640..3966854 (-) | 1215 | WP_119900007.1 | MFS transporter | - |
| DJ572_RS20550 (DJ572_20425) | yybE | 3967042..3967920 (+) | 879 | WP_015715067.1 | LysR family transcriptional regulator | - |
| DJ572_RS20555 (DJ572_20430) | yybD | 3967934..3968377 (+) | 444 | WP_029726103.1 | GNAT family N-acetyltransferase | - |
| DJ572_RS20560 (DJ572_20435) | yybC | 3968460..3968939 (+) | 480 | WP_119900009.1 | DUF2798 domain-containing protein | - |
| DJ572_RS21790 (DJ572_20440) | - | 3968964..3969097 (-) | 134 | Protein_3991 | LysR family transcriptional regulator | - |
| DJ572_RS20570 (DJ572_20445) | yybB | 3969114..3969776 (-) | 663 | WP_116315643.1 | MBL fold metallo-hydrolase | - |
| DJ572_RS20575 (DJ572_20450) | yybA | 3969946..3970398 (-) | 453 | WP_003226875.1 | MarR family transcriptional regulator | - |
| DJ572_RS20580 (DJ572_20455) | yyaT | 3970520..3970960 (+) | 441 | WP_038429960.1 | GNAT family N-acetyltransferase | - |
| DJ572_RS20585 (DJ572_20460) | yyaS | 3970962..3971564 (+) | 603 | WP_017695807.1 | YitT family protein | - |
| DJ572_RS20590 (DJ572_20465) | satA | 3971632..3972153 (-) | 522 | WP_119900011.1 | streptothricin N-acetyltransferase SatA | - |
| DJ572_RS20595 (DJ572_20470) | yyaQ | 3972562..3972918 (+) | 357 | WP_029726097.1 | MmcQ/YjbR family DNA-binding protein | - |
| DJ572_RS20600 (DJ572_20475) | yyaP | 3973078..3973644 (+) | 567 | WP_029726096.1 | dihydrofolate reductase family protein | - |
| DJ572_RS20605 (DJ572_20480) | - | 3973903..3974053 (+) | 151 | Protein_3999 | DUF255 domain-containing protein | - |
| DJ572_RS20610 (DJ572_20485) | tet(L) | 3974156..3975532 (-) | 1377 | WP_119900013.1 | tetracycline efflux MFS transporter Tet(L) | - |
| DJ572_RS21850 | tetL | 3975566..3975628 (-) | 63 | WP_010886645.1 | tetracycline resistance efflux system leader peptide | - |
| DJ572_RS20620 (DJ572_20495) | - | 3975881..3976051 (+) | 171 | Protein_4002 | DUF255 domain-containing protein | - |
| DJ572_RS20625 (DJ572_20500) | arsC | 3976128..3976547 (-) | 420 | WP_004398596.1 | thioredoxin-dependent arsenate reductase | - |
| DJ572_RS20630 (DJ572_20505) | acr3 | 3976559..3977599 (-) | 1041 | WP_119900017.1 | arsenite efflux transporter Acr3 | - |
| DJ572_RS20635 (DJ572_20510) | arsK | 3977621..3978061 (-) | 441 | WP_119900019.1 | ArsI/CadI family heavy metal resistance metalloenzyme | - |
| DJ572_RS20640 (DJ572_20515) | arsR | 3978121..3978438 (-) | 318 | WP_029318103.1 | arsenical resistance operon transcriptional regulator ArsR | - |
| DJ572_RS20645 (DJ572_20520) | - | 3978713..3980221 (+) | 1509 | WP_119900021.1 | recombinase family protein | - |
| DJ572_RS20650 (DJ572_20525) | - | 3980321..3981103 (-) | 783 | WP_119900023.1 | hypothetical protein | - |
| DJ572_RS20655 (DJ572_20530) | - | 3981205..3981597 (-) | 393 | WP_205590911.1 | cystatin-like fold lipoprotein | - |
| DJ572_RS20660 (DJ572_20535) | - | 3981651..3982157 (-) | 507 | WP_119900027.1 | hypothetical protein | - |
| DJ572_RS20665 (DJ572_20540) | cwlT | 3982172..3983161 (-) | 990 | WP_119900029.1 | bifunctional lytic transglycosylase/C40 family peptidase | - |
| DJ572_RS20670 (DJ572_20545) | - | 3983158..3985605 (-) | 2448 | WP_119900031.1 | CD3337/EF1877 family mobilome membrane protein | - |
| DJ572_RS20675 (DJ572_20550) | yddF | 3985609..3985935 (-) | 327 | WP_019716380.1 | YddF family protein | - |
| DJ572_RS20680 (DJ572_20555) | conE | 3985953..3988448 (-) | 2496 | WP_119900033.1 | VirB4-like ATPase ConE | - |
| DJ572_RS20685 (DJ572_20560) | conD | 3988336..3988860 (-) | 525 | WP_119900035.1 | conjugal transfer protein | - |
| DJ572_RS20690 (DJ572_20565) | - | 3988873..3989121 (-) | 249 | WP_119900037.1 | hypothetical protein | - |
| DJ572_RS20695 (DJ572_20570) | conB | 3989133..3990197 (-) | 1065 | WP_119900038.1 | conjugal transfer protein | - |
| DJ572_RS21540 | - | 3990215..3990373 (-) | 159 | WP_162920081.1 | hypothetical protein | - |
| DJ572_RS20700 (DJ572_20575) | - | 3990391..3990669 (-) | 279 | WP_044430163.1 | hypothetical protein | - |
| DJ572_RS20705 (DJ572_20580) | - | 3990686..3990952 (-) | 267 | WP_119900040.1 | hypothetical protein | - |
| DJ572_RS20710 (DJ572_20585) | nicK | 3991219..3992277 (-) | 1059 | WP_119900042.1 | DNA relaxase NicK | - |
| DJ572_RS20715 (DJ572_20590) | - | 3992270..3993721 (-) | 1452 | WP_119900044.1 | DNA translocase FtsK | - |
| DJ572_RS20720 (DJ572_20595) | helP | 3993757..3994137 (-) | 381 | WP_119900046.1 | helicase processivity factor HelP | - |
| DJ572_RS20725 | - | 3994154..3994300 (-) | 147 | WP_119900048.1 | hypothetical protein | - |
| DJ572_RS20730 (DJ572_20600) | - | 3994505..3994765 (-) | 261 | WP_119900050.1 | hypothetical protein | - |
| DJ572_RS20735 (DJ572_20605) | - | 3994818..3995078 (-) | 261 | WP_119900052.1 | hypothetical protein | - |
| DJ572_RS20740 (DJ572_20610) | - | 3995075..3995254 (-) | 180 | WP_119900054.1 | ICEBs1 excisionase | - |
| DJ572_RS20745 (DJ572_20615) | - | 3995551..3995934 (+) | 384 | WP_019716391.1 | helix-turn-helix transcriptional regulator | - |
| DJ572_RS20750 (DJ572_20620) | - | 3995931..3996461 (+) | 531 | WP_019716392.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DJ572_RS20755 (DJ572_20625) | - | 3996574..3997770 (-) | 1197 | WP_119900056.1 | Rap family tetratricopeptide repeat protein | - |
| DJ572_RS20760 (DJ572_20630) | - | 3997989..3998756 (+) | 768 | WP_119900058.1 | hypothetical protein | - |
| DJ572_RS20765 (DJ572_20635) | - | 3998773..3999597 (+) | 825 | WP_119900060.1 | hypothetical protein | - |
| DJ572_RS20775 (DJ572_20645) | yyaL | 3999602..4001691 (+) | 2090 | Protein_4033 | thioredoxin domain-containing protein | - |
| DJ572_RS20780 (DJ572_20650) | yyaK | 4001688..4002587 (-) | 900 | WP_119900140.1 | type II CAAX endopeptidase family protein | - |
| DJ572_RS20785 (DJ572_20655) | yyaJ | 4002815..4004170 (+) | 1356 | WP_119900063.1 | MFS transporter | - |
| DJ572_RS20790 (DJ572_20660) | maa | 4004204..4004758 (-) | 555 | WP_033884396.1 | sugar O-acetyltransferase | - |
| DJ572_RS20795 (DJ572_20665) | yyaH | 4004774..4005154 (-) | 381 | WP_119900065.1 | VOC family protein | - |
| DJ572_RS20800 (DJ572_20670) | ccpB | 4005210..4006145 (-) | 936 | WP_119900067.1 | transcriptional regulator CcpB | - |
| DJ572_RS20805 (DJ572_20675) | xth | 4006204..4006962 (-) | 759 | WP_029726087.1 | exodeoxyribonuclease III | - |
| DJ572_RS20810 (DJ572_20680) | rpsR | 4007026..4007265 (-) | 240 | WP_003219224.1 | 30S ribosomal protein S18 | - |
| DJ572_RS20815 (DJ572_20685) | ssbA | 4007309..4007827 (-) | 519 | WP_003219228.1 | single-stranded DNA-binding protein SsbA | Machinery gene |
Sequence
Protein
Download Length: 172 a.a. Molecular weight: 18742.31 Da Isoelectric Point: 4.7621
>NTDB_id=292611 DJ572_RS20815 WP_003219228.1 4007309..4007827(-) (ssbA) [Bacillus subtilis strain QB61]
MLNRVVLVGRLTKDPELRYTPNGAAVATFTLAVNRTFTNQSGEREADFINCVTWRRQAENVANFLKKGSLAGVDGRLQTR
NYENQQGQRVFVTEVQAESVQFLEPKNGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQRRNQGNSFNDDPFANDG
KPIDISDDDLPF
MLNRVVLVGRLTKDPELRYTPNGAAVATFTLAVNRTFTNQSGEREADFINCVTWRRQAENVANFLKKGSLAGVDGRLQTR
NYENQQGQRVFVTEVQAESVQFLEPKNGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQRRNQGNSFNDDPFANDG
KPIDISDDDLPF
Nucleotide
Download Length: 519 bp
>NTDB_id=292611 DJ572_RS20815 WP_003219228.1 4007309..4007827(-) (ssbA) [Bacillus subtilis strain QB61]
ATGCTTAACCGAGTTGTATTAGTCGGAAGACTGACAAAAGACCCAGAGCTTCGTTATACGCCAAACGGTGCGGCTGTTGC
TACGTTTACTCTTGCTGTGAATCGTACATTTACGAACCAGTCCGGAGAACGTGAGGCCGATTTCATTAATTGTGTCACTT
GGAGAAGACAAGCCGAAAACGTTGCAAACTTCTTGAAAAAAGGAAGCCTTGCAGGCGTAGATGGCCGTTTACAAACAAGA
AACTATGAAAACCAGCAAGGACAGCGTGTCTTCGTGACAGAGGTCCAAGCTGAAAGTGTTCAATTTCTTGAGCCGAAAAA
CGGCGGCGGTTCTGGTTCAGGTGGATACAACGAAGGAAACAGCGGCGGAGGCCAGTACTTTGGCGGAGGCCAAAATGATA
ATCCATTTGGGGGAAATCAAAACAACCAGAGACGCAATCAGGGGAACAGCTTTAATGATGACCCATTTGCCAACGACGGC
AAACCGATTGACATCTCGGATGATGATCTTCCATTCTAA
ATGCTTAACCGAGTTGTATTAGTCGGAAGACTGACAAAAGACCCAGAGCTTCGTTATACGCCAAACGGTGCGGCTGTTGC
TACGTTTACTCTTGCTGTGAATCGTACATTTACGAACCAGTCCGGAGAACGTGAGGCCGATTTCATTAATTGTGTCACTT
GGAGAAGACAAGCCGAAAACGTTGCAAACTTCTTGAAAAAAGGAAGCCTTGCAGGCGTAGATGGCCGTTTACAAACAAGA
AACTATGAAAACCAGCAAGGACAGCGTGTCTTCGTGACAGAGGTCCAAGCTGAAAGTGTTCAATTTCTTGAGCCGAAAAA
CGGCGGCGGTTCTGGTTCAGGTGGATACAACGAAGGAAACAGCGGCGGAGGCCAGTACTTTGGCGGAGGCCAAAATGATA
ATCCATTTGGGGGAAATCAAAACAACCAGAGACGCAATCAGGGGAACAGCTTTAATGATGACCCATTTGCCAACGACGGC
AAACCGATTGACATCTCGGATGATGATCTTCCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
58.192 |
100 |
0.599 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
64.151 |
61.628 |
0.395 |
| ssb | Glaesserella parasuis strain SC1401 |
35.519 |
100 |
0.378 |