Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   DJ572_RS15840 Genome accession   NZ_CP029461
Coordinates   3032755..3032895 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain QB61     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3027755..3037895
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DJ572_RS15815 (DJ572_15725) yuxO 3028064..3028444 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  DJ572_RS15820 (DJ572_15730) comA 3028463..3029107 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  DJ572_RS15825 (DJ572_15735) comP 3029188..3031497 (-) 2310 WP_119899725.1 two-component system sensor histidine kinase ComP Regulator
  DJ572_RS15830 (DJ572_15740) comX 3031516..3031683 (-) 168 WP_101501417.1 competence pheromone ComX Regulator
  DJ572_RS15835 (DJ572_15745) comQ 3031701..3032570 (-) 870 WP_119899727.1 ComX modifying isoprenyl transferase ComQ Regulator
  DJ572_RS15840 (DJ572_15750) degQ 3032755..3032895 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  DJ572_RS15845 - 3033117..3033242 (+) 126 WP_003228793.1 hypothetical protein -
  DJ572_RS15850 (DJ572_15755) - 3033358..3033726 (+) 369 WP_119899729.1 hypothetical protein -
  DJ572_RS15855 (DJ572_15760) pdeH 3033702..3034931 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  DJ572_RS15860 (DJ572_15765) pncB 3035068..3036540 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  DJ572_RS15865 (DJ572_15770) pncA 3036556..3037107 (-) 552 WP_088326850.1 isochorismatase family cysteine hydrolase -
  DJ572_RS15870 (DJ572_15775) yueI 3037204..3037602 (-) 399 WP_015251331.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=292597 DJ572_RS15840 WP_003220708.1 3032755..3032895(-) (degQ) [Bacillus subtilis strain QB61]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=292597 DJ572_RS15840 WP_003220708.1 3032755..3032895(-) (degQ) [Bacillus subtilis strain QB61]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment