Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   DJ572_RS15830 Genome accession   NZ_CP029461
Coordinates   3031516..3031683 (-) Length   55 a.a.
NCBI ID   WP_101501417.1    Uniprot ID   -
Organism   Bacillus subtilis strain QB61     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3026516..3036683
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DJ572_RS15800 (DJ572_15710) mrpE 3026905..3027381 (+) 477 WP_003228815.1 Na+/H+ antiporter subunit E -
  DJ572_RS15805 (DJ572_15715) mrpF 3027381..3027665 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  DJ572_RS15810 (DJ572_15720) mnhG 3027649..3028023 (+) 375 WP_014477830.1 monovalent cation/H(+) antiporter subunit G -
  DJ572_RS15815 (DJ572_15725) yuxO 3028064..3028444 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  DJ572_RS15820 (DJ572_15730) comA 3028463..3029107 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  DJ572_RS15825 (DJ572_15735) comP 3029188..3031497 (-) 2310 WP_119899725.1 two-component system sensor histidine kinase ComP Regulator
  DJ572_RS15830 (DJ572_15740) comX 3031516..3031683 (-) 168 WP_101501417.1 competence pheromone ComX Regulator
  DJ572_RS15835 (DJ572_15745) comQ 3031701..3032570 (-) 870 WP_119899727.1 ComX modifying isoprenyl transferase ComQ Regulator
  DJ572_RS15840 (DJ572_15750) degQ 3032755..3032895 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  DJ572_RS15845 - 3033117..3033242 (+) 126 WP_003228793.1 hypothetical protein -
  DJ572_RS15850 (DJ572_15755) - 3033358..3033726 (+) 369 WP_119899729.1 hypothetical protein -
  DJ572_RS15855 (DJ572_15760) pdeH 3033702..3034931 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  DJ572_RS15860 (DJ572_15765) pncB 3035068..3036540 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6674.65 Da        Isoelectric Point: 4.9431

>NTDB_id=292595 DJ572_RS15830 WP_101501417.1 3031516..3031683(-) (comX) [Bacillus subtilis strain QB61]
MQDLINYFLNYPEVLKKLKNKEACLIGFDVQETETIIKAYNDYYRADPITRQWKE

Nucleotide


Download         Length: 168 bp        

>NTDB_id=292595 DJ572_RS15830 WP_101501417.1 3031516..3031683(-) (comX) [Bacillus subtilis strain QB61]
ATGCAAGACTTAATTAACTACTTTTTAAATTATCCAGAGGTTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTACAATGATTATTATCGGGCTGACCCAATAACTCGTCAATGGA
AAGAATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

92.727

100

0.927


Multiple sequence alignment