Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   DIC78_RS19090 Genome accession   NZ_CP029364
Coordinates   3700829..3701203 (+) Length   124 a.a.
NCBI ID   WP_106020094.1    Uniprot ID   -
Organism   Bacillus halotolerans strain ZB201702     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 3695829..3706203
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DIC78_RS19055 (DIC78_19080) - 3696532..3696942 (+) 411 WP_106020097.1 CBS domain-containing protein -
  DIC78_RS19060 (DIC78_19085) comGA 3697263..3698333 (+) 1071 WP_127696768.1 competence protein ComGA Machinery gene
  DIC78_RS19065 (DIC78_19090) comGB 3698320..3699357 (+) 1038 WP_127696769.1 competence type IV pilus assembly protein ComGB Machinery gene
  DIC78_RS19070 (DIC78_19095) comGC 3699371..3699667 (+) 297 WP_010334925.1 competence type IV pilus major pilin ComGC Machinery gene
  DIC78_RS19075 (DIC78_19100) comGD 3699657..3700088 (+) 432 WP_044154579.1 competence type IV pilus minor pilin ComGD Machinery gene
  DIC78_RS19080 (DIC78_19105) comGE 3700072..3700419 (+) 348 WP_127696770.1 competence type IV pilus minor pilin ComGE Machinery gene
  DIC78_RS19085 (DIC78_19110) comGF 3700445..3700828 (+) 384 WP_038954226.1 competence type IV pilus minor pilin ComGF Machinery gene
  DIC78_RS19090 (DIC78_19115) comGG 3700829..3701203 (+) 375 WP_106020094.1 competence type IV pilus minor pilin ComGG Machinery gene
  DIC78_RS19095 (DIC78_19120) - 3701275..3701454 (+) 180 WP_003236949.1 YqzE family protein -
  DIC78_RS19100 (DIC78_19125) - 3701497..3701820 (-) 324 WP_024122040.1 YqzG/YhdC family protein -
  DIC78_RS19105 (DIC78_19130) tapA 3702097..3702858 (+) 762 WP_106020093.1 amyloid fiber anchoring/assembly protein TapA -
  DIC78_RS19110 (DIC78_19135) sipW 3702830..3703414 (+) 585 WP_105955579.1 signal peptidase I SipW -
  DIC78_RS19115 (DIC78_19140) tasA 3703479..3704264 (+) 786 WP_127696771.1 biofilm matrix protein TasA -
  DIC78_RS19120 (DIC78_19145) sinR 3704351..3704686 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  DIC78_RS19125 (DIC78_19150) sinI 3704720..3704893 (-) 174 WP_127696772.1 anti-repressor SinI Regulator
  DIC78_RS19130 (DIC78_19155) - 3705077..3705871 (-) 795 WP_127696773.1 YqhG family protein -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14484.58 Da        Isoelectric Point: 9.2100

>NTDB_id=292009 DIC78_RS19090 WP_106020094.1 3700829..3701203(+) (comGG) [Bacillus halotolerans strain ZB201702]
MYYSKGFIYPAVLFTFALVMLIVNFTAPQFVSRHMFEQETKEYYTGENLLQNGALLSIRHILEHRPGRKGSQQFQYGHVS
YDIRKTTIKEQQEITLKAITESGTEKSAQLLFDQNQKKLLSWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=292009 DIC78_RS19090 WP_106020094.1 3700829..3701203(+) (comGG) [Bacillus halotolerans strain ZB201702]
ATGTACTACTCAAAAGGGTTTATCTATCCGGCCGTTCTTTTTACATTTGCCCTTGTGATGCTGATTGTGAATTTCACCGC
CCCTCAATTTGTTTCACGCCATATGTTTGAGCAGGAAACAAAAGAGTATTACACAGGAGAAAATCTGCTGCAAAATGGCG
CGCTTCTATCCATCAGGCATATACTTGAGCACAGACCAGGCCGAAAGGGTTCACAGCAGTTTCAATATGGACATGTATCT
TATGACATTCGCAAAACAACCATAAAAGAACAGCAAGAAATCACTCTTAAAGCCATCACAGAGTCGGGAACAGAAAAAAG
CGCTCAGCTGCTGTTCGATCAAAATCAGAAAAAACTGCTGAGCTGGACAGAATAA

Domains


Predicted by InterProScan.

(31-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

68.548

100

0.685


Multiple sequence alignment