Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   DDT09_RS15255 Genome accession   NZ_CP029070
Coordinates   3076862..3077002 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain ALB69     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3071862..3082002
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DDT09_RS15230 (DDT09_15230) - 3072158..3072541 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  DDT09_RS15235 (DDT09_15235) comA 3072563..3073207 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  DDT09_RS15240 (DDT09_15240) comP 3073288..3075597 (-) 2310 WP_061862531.1 histidine kinase Regulator
  DDT09_RS15245 (DDT09_15245) comX 3075617..3075793 (-) 177 WP_007408675.1 competence pheromone ComX -
  DDT09_RS15250 (DDT09_15250) comQ 3075793..3076677 (-) 885 WP_061862640.1 class 1 isoprenoid biosynthesis enzyme Regulator
  DDT09_RS15255 (DDT09_15255) degQ 3076862..3077002 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  DDT09_RS15265 (DDT09_15265) - 3077468..3077809 (+) 342 WP_061862532.1 hypothetical protein -
  DDT09_RS15270 (DDT09_15270) - 3077816..3079039 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  DDT09_RS15275 (DDT09_15275) - 3079169..3080635 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  DDT09_RS15280 (DDT09_15280) - 3080653..3081204 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  DDT09_RS15285 (DDT09_15285) - 3081301..3081699 (-) 399 WP_061862533.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=289984 DDT09_RS15255 WP_003152043.1 3076862..3077002(-) (degQ) [Bacillus amyloliquefaciens strain ALB69]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=289984 DDT09_RS15255 WP_003152043.1 3076862..3077002(-) (degQ) [Bacillus amyloliquefaciens strain ALB69]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAATAAAAGCATTGATCAGCTCGATAAATTCTCATATGCTATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment