Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   DDT09_RS12245 Genome accession   NZ_CP029070
Coordinates   2512452..2512766 (-) Length   104 a.a.
NCBI ID   WP_061862391.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain ALB69     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2507452..2517766
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DDT09_RS12200 (DDT09_12200) sinI 2508133..2508306 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  DDT09_RS12205 (DDT09_12205) sinR 2508340..2508675 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  DDT09_RS12210 (DDT09_12210) - 2508723..2509508 (-) 786 WP_007408329.1 TasA family protein -
  DDT09_RS12215 (DDT09_12215) - 2509573..2510157 (-) 585 WP_014418370.1 signal peptidase I -
  DDT09_RS12220 (DDT09_12220) tapA 2510129..2510800 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  DDT09_RS12225 (DDT09_12225) - 2511059..2511388 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  DDT09_RS12230 (DDT09_12230) - 2511429..2511608 (-) 180 WP_003153093.1 YqzE family protein -
  DDT09_RS12235 (DDT09_12235) comGG 2511665..2512042 (-) 378 WP_061862389.1 competence type IV pilus minor pilin ComGG Machinery gene
  DDT09_RS12240 (DDT09_12240) comGF 2512043..2512438 (-) 396 WP_061862390.1 competence type IV pilus minor pilin ComGF -
  DDT09_RS12245 (DDT09_12245) comGE 2512452..2512766 (-) 315 WP_061862391.1 competence type IV pilus minor pilin ComGE Machinery gene
  DDT09_RS12250 (DDT09_12250) comGD 2512750..2513187 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  DDT09_RS12255 (DDT09_12255) comGC 2513177..2513443 (-) 267 WP_050496152.1 competence type IV pilus major pilin ComGC Machinery gene
  DDT09_RS12260 (DDT09_12260) comGB 2513490..2514527 (-) 1038 WP_061862392.1 competence type IV pilus assembly protein ComGB Machinery gene
  DDT09_RS12265 (DDT09_12265) comGA 2514514..2515584 (-) 1071 WP_061862635.1 competence type IV pilus ATPase ComGA Machinery gene
  DDT09_RS12270 (DDT09_12270) - 2515777..2516727 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11906.89 Da        Isoelectric Point: 5.8241

>NTDB_id=289964 DDT09_RS12245 WP_061862391.1 2512452..2512766(-) (comGE) [Bacillus amyloliquefaciens strain ALB69]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMMTDGLKIDDRQEAYQLLQKHISTYMMTGKKPPSPDVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=289964 DDT09_RS12245 WP_061862391.1 2512452..2512766(-) (comGE) [Bacillus amyloliquefaciens strain ALB69]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGATGACAGATGGTCTGAAAATAGATGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGATGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGTGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481

Multiple sequence alignment