Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   EJJ34_RS17365 Genome accession   NZ_CP034484
Coordinates   3252321..3252461 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 = DSM 10 strain NCIB 3610     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3247321..3257461
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EJJ34_RS17340 (EJJ34_17345) yuxO 3247634..3248014 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  EJJ34_RS17345 (EJJ34_17350) comA 3248033..3248677 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  EJJ34_RS17350 (EJJ34_17355) comP 3248758..3251067 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  EJJ34_RS17355 (EJJ34_17360) comX 3251082..3251249 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  EJJ34_RS17360 (EJJ34_17365) comQ 3251237..3252136 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  EJJ34_RS17365 (EJJ34_17370) degQ 3252321..3252461 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  EJJ34_RS17370 (EJJ34_17375) - 3252683..3252808 (+) 126 WP_003228793.1 hypothetical protein -
  EJJ34_RS17375 (EJJ34_17380) - 3252922..3253290 (+) 369 WP_003243784.1 hypothetical protein -
  EJJ34_RS17380 (EJJ34_17385) pdeH 3253266..3254487 (-) 1222 Protein_3333 cyclic di-GMP phosphodiesterase -
  EJJ34_RS17385 (EJJ34_17390) pncB 3254624..3256096 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  EJJ34_RS17390 (EJJ34_17395) pncA 3256112..3256663 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  EJJ34_RS17395 (EJJ34_17400) yueI 3256760..3257158 (-) 399 WP_003242987.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=289963 EJJ34_RS17365 WP_003220708.1 3252321..3252461(-) (degQ) [Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 = DSM 10 strain NCIB 3610]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=289963 EJJ34_RS17365 WP_003220708.1 3252321..3252461(-) (degQ) [Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 = DSM 10 strain NCIB 3610]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment