Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | DDT09_RS12200 | Genome accession | NZ_CP029070 |
| Coordinates | 2508133..2508306 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus amyloliquefaciens strain ALB69 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2503133..2513306
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DDT09_RS12185 (DDT09_12185) | gcvT | 2503946..2505046 (-) | 1101 | WP_061862388.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| DDT09_RS12190 (DDT09_12190) | - | 2505470..2507140 (+) | 1671 | WP_021494309.1 | SNF2-related protein | - |
| DDT09_RS12195 (DDT09_12195) | - | 2507162..2507956 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| DDT09_RS12200 (DDT09_12200) | sinI | 2508133..2508306 (+) | 174 | WP_014418369.1 | anti-repressor SinI family protein | Regulator |
| DDT09_RS12205 (DDT09_12205) | sinR | 2508340..2508675 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| DDT09_RS12210 (DDT09_12210) | - | 2508723..2509508 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| DDT09_RS12215 (DDT09_12215) | - | 2509573..2510157 (-) | 585 | WP_014418370.1 | signal peptidase I | - |
| DDT09_RS12220 (DDT09_12220) | tapA | 2510129..2510800 (-) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| DDT09_RS12225 (DDT09_12225) | - | 2511059..2511388 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| DDT09_RS12230 (DDT09_12230) | - | 2511429..2511608 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| DDT09_RS12235 (DDT09_12235) | comGG | 2511665..2512042 (-) | 378 | WP_061862389.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| DDT09_RS12240 (DDT09_12240) | comGF | 2512043..2512438 (-) | 396 | WP_061862390.1 | competence type IV pilus minor pilin ComGF | - |
| DDT09_RS12245 (DDT09_12245) | comGE | 2512452..2512766 (-) | 315 | WP_061862391.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| DDT09_RS12250 (DDT09_12250) | comGD | 2512750..2513187 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=289961 DDT09_RS12200 WP_014418369.1 2508133..2508306(+) (sinI) [Bacillus amyloliquefaciens strain ALB69]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=289961 DDT09_RS12200 WP_014418369.1 2508133..2508306(+) (sinI) [Bacillus amyloliquefaciens strain ALB69]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |