Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinR   Type   Regulator
Locus tag   EJJ34_RS13440 Genome accession   NZ_CP034484
Coordinates   2547879..2548214 (+) Length   111 a.a.
NCBI ID   WP_003226345.1    Uniprot ID   A0ABU0V3E1
Organism   Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 = DSM 10 strain NCIB 3610     
Function   repression of rok; repression of degU; repression of spo0A (predicted from homology)   
Competence regulation

Genomic Context


Location: 2542879..2553214
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EJJ34_RS13420 (EJJ34_13425) gcvT 2543471..2544559 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  EJJ34_RS13425 (EJJ34_13430) hepAA 2545001..2546674 (+) 1674 WP_004398544.1 SNF2-related protein -
  EJJ34_RS13430 (EJJ34_13435) yqhG 2546695..2547489 (+) 795 WP_003230200.1 YqhG family protein -
  EJJ34_RS13435 (EJJ34_13440) sinI 2547672..2547845 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  EJJ34_RS13440 (EJJ34_13445) sinR 2547879..2548214 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  EJJ34_RS13445 (EJJ34_13450) tasA 2548307..2549092 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  EJJ34_RS13450 (EJJ34_13455) sipW 2549156..2549728 (-) 573 WP_003246088.1 signal peptidase I SipW -
  EJJ34_RS13455 (EJJ34_13460) tapA 2549712..2550473 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  EJJ34_RS13460 (EJJ34_13465) yqzG 2550745..2551071 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  EJJ34_RS13465 (EJJ34_13470) spoIITA 2551113..2551292 (-) 180 WP_003230176.1 YqzE family protein -
  EJJ34_RS13470 (EJJ34_13475) comGG 2551363..2551737 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  EJJ34_RS13475 (EJJ34_13480) comGF 2551738..2552121 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  EJJ34_RS13480 (EJJ34_13485) comGE 2552147..2552494 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  EJJ34_RS13485 (EJJ34_13490) comGD 2552478..2552909 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  EJJ34_RS13490 (EJJ34_13495) comGC 2552899..2553195 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene

Sequence


Protein


Download         Length: 111 a.a.        Molecular weight: 12988.64 Da        Isoelectric Point: 7.2023

>NTDB_id=289927 EJJ34_RS13440 WP_003226345.1 2547879..2548214(+) (sinR) [Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 = DSM 10 strain NCIB 3610]
MIGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERNLQTNPSIQFLEKVSAVLDVSVHTLLDEKHETEYDGQLDSEWEK
LVRDAMTSGVSKKQFREFLDYQKWRKSQKEE

Nucleotide


Download         Length: 336 bp        

>NTDB_id=289927 EJJ34_RS13440 WP_003226345.1 2547879..2548214(+) (sinR) [Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 = DSM 10 strain NCIB 3610]
TTGATTGGCCAGCGTATTAAACAATACCGTAAAGAAAAAGGCTACTCACTATCAGAACTAGCTGAAAAAGCTGGGGTAGC
GAAGTCTTATTTAAGCTCAATAGAACGAAATCTACAAACGAACCCCTCCATTCAATTTCTCGAAAAAGTCTCCGCTGTTC
TGGACGTCTCGGTTCATACTTTGCTCGATGAGAAACATGAAACCGAATACGATGGTCAATTAGATAGTGAATGGGAGAAA
TTGGTTCGCGATGCGATGACATCCGGGGTATCGAAAAAACAATTTCGTGAATTTTTAGATTATCAAAAATGGAGAAAATC
CCAAAAAGAGGAGTAG

Domains


Predicted by InterProScan.

(6-58)

(74-101)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinR Bacillus subtilis subsp. subtilis str. 168

100

100

1