Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   DBK22_RS10435 Genome accession   NZ_CP028961
Coordinates   2120052..2120192 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain SRCM102752     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2115052..2125192
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DBK22_RS10410 (DBK22_02095) - 2115349..2115732 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  DBK22_RS10415 (DBK22_02096) comA 2115754..2116398 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  DBK22_RS10420 (DBK22_02097) comP 2116479..2118782 (-) 2304 WP_160242253.1 histidine kinase Regulator
  DBK22_RS10430 (DBK22_02099) comQ 2118935..2119921 (-) 987 WP_308219300.1 class 1 isoprenoid biosynthesis enzyme Regulator
  DBK22_RS10435 (DBK22_02100) degQ 2120052..2120192 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  DBK22_RS10440 (DBK22_02101) - 2120658..2120999 (+) 342 WP_082998527.1 hypothetical protein -
  DBK22_RS10445 (DBK22_02102) - 2121006..2122229 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  DBK22_RS10450 (DBK22_02103) - 2122359..2123825 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  DBK22_RS10455 (DBK22_02104) - 2123843..2124394 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  DBK22_RS10460 (DBK22_02105) - 2124491..2124889 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=289003 DBK22_RS10435 WP_003152043.1 2120052..2120192(-) (degQ) [Bacillus velezensis strain SRCM102752]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=289003 DBK22_RS10435 WP_003152043.1 2120052..2120192(-) (degQ) [Bacillus velezensis strain SRCM102752]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment