Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   AOY78_RS07225 Genome accession   NZ_CP028750
Coordinates   1512285..1512791 (-) Length   168 a.a.
NCBI ID   WP_000168274.1    Uniprot ID   A0A9X0Q0X8
Organism   Escherichia coli strain A25     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1497764..1540383 1512285..1512791 within 0


Gene organization within MGE regions


Location: 1497764..1540383
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AOY78_RS07145 (AOY78_07580) modC 1497764..1498822 (+) 1059 WP_024242256.1 molybdenum ABC transporter ATP-binding protein ModC -
  AOY78_RS07150 (AOY78_07585) ybhA 1498823..1499641 (-) 819 WP_001339356.1 bifunctional pyridoxal phosphate/fructose-1,6-bisphosphate phosphatase -
  AOY78_RS07155 (AOY78_07590) pgl 1499796..1500791 (+) 996 WP_000815414.1 6-phosphogluconolactonase -
  AOY78_RS07160 (AOY78_07595) ybhD 1500832..1501785 (-) 954 WP_000679972.1 LysR family transcriptional regulator -
  AOY78_RS07165 (AOY78_07600) ybhH 1501969..1503021 (+) 1053 WP_024231748.1 4-oxalomesaconate tautomerase -
  AOY78_RS07170 (AOY78_07605) ybhI 1503097..1504530 (+) 1434 WP_001036491.1 anion permease -
  AOY78_RS07175 (AOY78_07610) ybhJ 1504713..1506974 (+) 2262 WP_096891234.1 hydratase -
  AOY78_RS07180 (AOY78_07615) ybhC 1507114..1508397 (-) 1284 WP_001091562.1 putative acyl-CoA thioester hydrolase -
  AOY78_RS07185 (AOY78_07620) - 1508532..1509602 (-) 1071 WP_000533643.1 tyrosine-type recombinase/integrase -
  AOY78_RS07190 (AOY78_07625) - 1509580..1509798 (-) 219 WP_001303849.1 excisionase -
  AOY78_RS07195 (AOY78_07630) - 1509838..1510005 (-) 168 WP_000545728.1 hypothetical protein -
  AOY78_RS07200 (AOY78_07635) - 1510094..1510375 (-) 282 WP_000026224.1 hypothetical protein -
  AOY78_RS07205 (AOY78_07640) - 1510578..1511246 (-) 669 WP_024248030.1 ead/Ea22-like family protein -
  AOY78_RS07210 (AOY78_07645) - 1511243..1511806 (-) 564 WP_000827661.1 hypothetical protein -
  AOY78_RS07215 (AOY78_07650) - 1511803..1511967 (-) 165 WP_001214459.1 DUF2737 family protein -
  AOY78_RS07220 (AOY78_07655) - 1511978..1512271 (-) 294 WP_001111334.1 phage anti-RecBCD protein -
  AOY78_RS07225 (AOY78_07660) ssb 1512285..1512791 (-) 507 WP_000168274.1 single-stranded DNA-binding protein Machinery gene
  AOY78_RS07230 (AOY78_07665) - 1512792..1513499 (-) 708 WP_000365290.1 Rad52/Rad22 family DNA repair protein -
  AOY78_RS07235 (AOY78_07670) kil 1513754..1513906 (-) 153 WP_001243355.1 host cell division inhibitory peptide Kil -
  AOY78_RS22515 (AOY78_07675) - 1513891..1514025 (-) 135 WP_000972063.1 hypothetical protein -
  AOY78_RS07240 (AOY78_07680) - 1514101..1514469 (-) 369 WP_000065364.1 DUF2528 family protein -
  AOY78_RS07245 (AOY78_07685) - 1514620..1515090 (-) 471 WP_000167595.1 hypothetical protein -
  AOY78_RS07250 (AOY78_07690) - 1515159..1515431 (-) 273 WP_201488416.1 antitermination protein N -
  AOY78_RS07255 (AOY78_07695) - 1515409..1515631 (-) 223 Protein_1396 hypothetical protein -
  AOY78_RS07260 (AOY78_07700) - 1515870..1516712 (-) 843 WP_000032717.1 BRO family protein -
  AOY78_RS07265 (AOY78_07705) - 1516793..1517488 (-) 696 WP_096246228.1 LexA family transcriptional regulator -
  AOY78_RS07270 (AOY78_07710) - 1517564..1517779 (+) 216 WP_000067727.1 helix-turn-helix transcriptional regulator -
  AOY78_RS07275 (AOY78_07715) - 1517921..1518217 (+) 297 WP_000438530.1 CII family transcriptional regulator -
  AOY78_RS07280 (AOY78_07720) - 1518250..1519149 (+) 900 WP_000185505.1 replication protein -
  AOY78_RS07285 (AOY78_07725) - 1519146..1519847 (+) 702 WP_000788881.1 replication protein P -
  AOY78_RS07290 (AOY78_07730) - 1519844..1520134 (+) 291 WP_000145926.1 protein ren -
  AOY78_RS07295 (AOY78_07735) - 1520207..1520533 (+) 327 WP_000796283.1 hypothetical protein -
  AOY78_RS07300 (AOY78_07740) - 1520556..1521002 (+) 447 WP_000810177.1 recombination protein NinB -
  AOY78_RS07305 (AOY78_07745) - 1520999..1521526 (+) 528 WP_201488415.1 phage N-6-adenine-methyltransferase -
  AOY78_RS07310 (AOY78_07750) - 1521523..1521705 (+) 183 WP_201488414.1 NinE family protein -
  AOY78_RS07315 (AOY78_07755) - 1521702..1521872 (+) 171 WP_000567007.1 protein NinF -
  AOY78_RS07320 (AOY78_07760) - 1521865..1522485 (+) 621 WP_024229307.1 recombination protein NinG -
  AOY78_RS07325 (AOY78_07765) - 1522482..1523147 (+) 666 WP_201488413.1 serine/threonine protein phosphatase -
  AOY78_RS07330 (AOY78_07770) - 1523144..1523767 (+) 624 WP_201488412.1 antitermination protein -
  AOY78_RS07335 (AOY78_07775) - 1524020..1524762 (+) 743 Protein_1412 hypothetical protein -
  AOY78_RS07340 (AOY78_07780) - 1524848..1525006 (+) 159 WP_000499456.1 DUF3927 family protein -
  AOY78_RS07345 - 1525087..1525485 (-) 399 WP_201488411.1 hypothetical protein -
  AOY78_RS07350 (AOY78_07785) - 1525628..1525843 (+) 216 WP_000284524.1 class II holin family protein -
  AOY78_RS07355 (AOY78_07790) - 1525843..1526340 (+) 498 WP_001591713.1 lysozyme -
  AOY78_RS07360 (AOY78_07795) - 1526337..1526804 (+) 468 WP_001591714.1 lysis protein -
  AOY78_RS07365 (AOY78_07800) - 1527003..1527527 (+) 525 WP_001059339.1 Rha family transcriptional regulator -
  AOY78_RS07370 (AOY78_07810) - 1528073..1528618 (+) 546 WP_000453576.1 DNA-packaging protein -
  AOY78_RS07375 (AOY78_07815) - 1528593..1528973 (+) 381 WP_240764835.1 hypothetical protein -
  AOY78_RS07380 (AOY78_07820) - 1528970..1529299 (+) 330 WP_000847332.1 phage tail protein -
  AOY78_RS07385 (AOY78_07825) - 1529299..1529997 (+) 699 WP_001152612.1 phage minor tail protein L -
  AOY78_RS07390 (AOY78_07830) - 1530003..1530746 (+) 744 WP_000194782.1 C40 family peptidase -
  AOY78_RS07395 (AOY78_07835) - 1530743..1531315 (+) 573 WP_024227135.1 tail assembly protein -
  AOY78_RS07400 (AOY78_07840) - 1531376..1535092 (+) 3717 WP_201488479.1 phage tail protein -
  AOY78_RS07405 (AOY78_07845) - 1535162..1535761 (+) 600 WP_201488480.1 Ail/Lom family outer membrane beta-barrel protein -
  AOY78_RS07410 - 1535826..1539152 (+) 3327 WP_240764836.1 prophage tail fiber N-terminal domain-containing protein -
  AOY78_RS07415 (AOY78_07865) - 1539505..1540383 (+) 879 WP_001591744.1 DUF1653 domain-containing protein -

Sequence


Protein


Download         Length: 168 a.a.        Molecular weight: 18731.03 Da        Isoelectric Point: 8.4877

>NTDB_id=287226 AOY78_RS07225 WP_000168274.1 1512285..1512791(-) (ssb) [Escherichia coli strain A25]
MASRGVNKVIILGRVGQDPEVRYSPSGTAFANLTIATSEQWRDKNTGEQKELTEWHRVAVSGKLAEVVGQYVKKGDQIYF
EGMLRTRKWKDQSGQDRYTTEVHVGINGVMQMLGGIGDSKQQAASRQSQKPQQQSSPAQHNEPPMDFDDDIPFAPVTLPF
PRHAIHAI

Nucleotide


Download         Length: 507 bp        

>NTDB_id=287226 AOY78_RS07225 WP_000168274.1 1512285..1512791(-) (ssb) [Escherichia coli strain A25]
ATGGCAAGCAGAGGCGTAAATAAGGTGATTATCCTTGGTCGGGTAGGACAAGACCCGGAAGTTCGATACTCACCATCAGG
AACAGCGTTCGCTAACCTGACAATAGCCACGTCAGAACAATGGCGAGATAAAAATACTGGCGAGCAAAAGGAATTGACTG
AATGGCATCGTGTTGCTGTATCCGGGAAACTGGCTGAGGTCGTGGGGCAGTATGTGAAAAAAGGTGATCAGATTTATTTC
GAGGGAATGCTGAGAACCAGAAAGTGGAAAGACCAGTCAGGGCAAGACCGTTACACAACCGAGGTTCATGTCGGAATTAA
TGGCGTGATGCAAATGCTTGGCGGCATTGGCGACAGCAAACAACAAGCAGCCAGCAGGCAATCACAGAAGCCACAGCAGC
AATCATCACCAGCACAACACAACGAACCTCCGATGGATTTTGACGACGATATACCCTTTGCACCAGTAACTCTCCCCTTC
CCTCGTCACGCTATTCACGCAATTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

62.147

100

0.655

  ssb Glaesserella parasuis strain SC1401

45.856

100

0.494

  ssb Neisseria meningitidis MC58

38.636

100

0.405

  ssb Neisseria gonorrhoeae MS11

38.636

100

0.405


Multiple sequence alignment