Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   ECRM9975_RS25865 Genome accession   NZ_CP028432
Coordinates   4874985..4875521 (+) Length   178 a.a.
NCBI ID   WP_000168305.1    Uniprot ID   A0A9P2PPK2
Organism   Escherichia coli strain RM9975     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 4827146..4875521 4874985..4875521 within 0


Gene organization within MGE regions


Location: 4827146..4875521
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ECRM9975_RS25570 (ECRM9975_25565) - 4827146..4827874 (-) 729 Protein_4717 IS3-like element IS1203 family transposase -
  ECRM9975_RS25575 (ECRM9975_25570) - 4827883..4828542 (+) 660 Protein_4718 DUF968 domain-containing protein -
  ECRM9975_RS25580 (ECRM9975_25575) - 4828556..4829308 (+) 753 WP_001047110.1 antitermination protein -
  ECRM9975_RS25590 (ECRM9975_25585) - 4829657..4829770 (+) 114 Protein_4720 DNA methylase -
  ECRM9975_RS25610 (ECRM9975_25605) - 4830588..4832438 (+) 1851 WP_000143076.1 SASA family carbohydrate esterase -
  ECRM9975_RS25620 (ECRM9975_25615) - 4832878..4833093 (+) 216 WP_024164617.1 class II holin family protein -
  ECRM9975_RS25625 (ECRM9975_25620) rrrD 4833093..4833590 (+) 498 WP_000075132.1 lysozyme RrrD -
  ECRM9975_RS29310 - 4833807..4833992 (+) 186 WP_001208681.1 Rz1 family lipoprotein -
  ECRM9975_RS25640 (ECRM9975_25635) - 4834520..4834834 (+) 315 WP_001303878.1 PerC family transcriptional regulator -
  ECRM9975_RS25645 (ECRM9975_25640) - 4834954..4835046 (-) 93 Protein_4726 DUF3950 domain-containing protein -
  ECRM9975_RS29960 - 4835088..4835411 (+) 324 Protein_4727 HNH endonuclease -
  ECRM9975_RS25655 (ECRM9975_25650) - 4835735..4836298 (+) 564 WP_000958398.1 terminase small subunit -
  ECRM9975_RS25660 (ECRM9975_25655) - 4836295..4837956 (+) 1662 WP_009453642.1 terminase large subunit -
  ECRM9975_RS25665 (ECRM9975_25660) - 4838020..4839957 (+) 1938 WP_000173088.1 phage major capsid protein -
  ECRM9975_RS25670 (ECRM9975_25665) - 4840002..4840223 (+) 222 WP_001063096.1 hypothetical protein -
  ECRM9975_RS25675 (ECRM9975_25670) - 4840169..4842590 (+) 2422 Protein_4732 phage portal protein -
  ECRM9975_RS25680 (ECRM9975_25675) - 4842587..4842913 (+) 327 WP_000125988.1 head-tail connector protein -
  ECRM9975_RS25685 (ECRM9975_25680) - 4842923..4843273 (+) 351 WP_001007905.1 phage head closure protein -
  ECRM9975_RS25690 (ECRM9975_25685) - 4843270..4843716 (+) 447 WP_000573374.1 HK97-gp10 family putative phage morphogenesis protein -
  ECRM9975_RS25695 (ECRM9975_25690) - 4843713..4844057 (+) 345 WP_000133388.1 DUF3168 domain-containing protein -
  ECRM9975_RS25700 (ECRM9975_25695) - 4844124..4844840 (+) 717 WP_001275461.1 major tail subunit -
  ECRM9975_RS25705 (ECRM9975_25700) - 4844846..4845220 (+) 375 WP_001030043.1 phage tail assembly chaperone -
  ECRM9975_RS25710 (ECRM9975_25705) - 4845316..4845525 (+) 210 WP_001453698.1 DUF4035 domain-containing protein -
  ECRM9975_RS25715 (ECRM9975_25710) - 4845577..4848819 (+) 3243 WP_000212952.1 phage tail tape measure protein -
  ECRM9975_RS25720 (ECRM9975_25715) - 4848812..4849153 (+) 342 WP_000807964.1 phage tail protein -
  ECRM9975_RS25725 (ECRM9975_25720) - 4849153..4849851 (+) 699 WP_001152209.1 phage minor tail protein L -
  ECRM9975_RS25730 (ECRM9975_25725) - 4849862..4850605 (+) 744 WP_000194763.1 C40 family peptidase -
  ECRM9975_RS25735 (ECRM9975_25730) - 4850602..4851183 (+) 582 WP_001089975.1 tail assembly protein -
  ECRM9975_RS25745 (ECRM9975_25740) - 4851419..4854895 (+) 3477 WP_112033856.1 host specificity protein J -
  ECRM9975_RS25750 (ECRM9975_25745) - 4854964..4855587 (+) 624 WP_001216290.1 Ail/Lom family outer membrane beta-barrel protein -
  ECRM9975_RS25755 (ECRM9975_25750) - 4855652..4856965 (+) 1314 WP_000279033.1 prophage tail fiber N-terminal domain-containing protein -
  ECRM9975_RS25760 (ECRM9975_25755) - 4856967..4857236 (+) 270 WP_001023417.1 phage tail fiber C-terminal domain-containing protein -
  ECRM9975_RS25765 (ECRM9975_25760) - 4857364..4857819 (+) 456 Protein_4749 DUF1076 domain-containing protein -
  ECRM9975_RS25770 (ECRM9975_25765) espW 4857950..4859008 (-) 1059 WP_001345294.1 T3SS effector EspW -
  ECRM9975_RS25775 (ECRM9975_25770) - 4859087..4859737 (-) 651 WP_001117798.1 DUF1076 domain-containing protein -
  ECRM9975_RS25780 (ECRM9975_25775) espM2 4859920..4860510 (+) 591 WP_001132154.1 T3SS effector guanine nucleotide exchange factor EspM2 -
  ECRM9975_RS25790 (ECRM9975_25785) - 4860744..4860896 (+) 153 Protein_4753 tail fiber assembly protein -
  ECRM9975_RS25795 (ECRM9975_25790) - 4861012..4861260 (-) 249 WP_001217542.1 DinI-like family protein -
  ECRM9975_RS25800 (ECRM9975_25795) - 4861322..4862420 (-) 1099 Protein_4755 site-specific integrase -
  ECRM9975_RS25805 (ECRM9975_25800) dusA 4862509..4863546 (+) 1038 WP_000543817.1 tRNA dihydrouridine(20/20a) synthase DusA -
  ECRM9975_RS25810 (ECRM9975_25805) pspG 4863680..4863922 (+) 243 WP_000891404.1 envelope stress response protein PspG -
  ECRM9975_RS25815 (ECRM9975_25810) qorA 4864088..4865071 (-) 984 WP_000235522.1 quinone oxidoreductase -
  ECRM9975_RS25820 (ECRM9975_25815) dnaB 4865154..4866569 (+) 1416 WP_000918363.1 replicative DNA helicase -
  ECRM9975_RS25825 (ECRM9975_25820) alr 4866622..4867701 (+) 1080 WP_001147328.1 alanine racemase -
  ECRM9975_RS25830 (ECRM9975_25825) tyrB 4867954..4869147 (+) 1194 WP_000486997.1 aromatic amino acid transaminase -
  ECRM9975_RS29965 - 4869369..4869620 (-) 252 WP_122989400.1 hypothetical protein -
  ECRM9975_RS29970 - 4869650..4869872 (-) 223 Protein_4763 hypothetical protein -
  ECRM9975_RS25840 (ECRM9975_25835) aphA 4870274..4870987 (+) 714 WP_001226928.1 acid phosphatase AphA -
  ECRM9975_RS25845 (ECRM9975_25840) yjbQ 4871098..4871514 (+) 417 WP_000270375.1 secondary thiamine-phosphate synthase enzyme YjbQ -
  ECRM9975_RS25850 (ECRM9975_25845) yjbR 4871518..4871874 (+) 357 WP_000155657.1 MmcQ/YjbR family DNA-binding protein -
  ECRM9975_RS25855 (ECRM9975_25850) uvrA 4871909..4874731 (-) 2823 WP_000357740.1 excinuclease ABC subunit UvrA -
  ECRM9975_RS25865 (ECRM9975_25860) ssb 4874985..4875521 (+) 537 WP_000168305.1 single-stranded DNA-binding protein SSB1 Machinery gene

Sequence


Protein


Download         Length: 178 a.a.        Molecular weight: 18975.00 Da        Isoelectric Point: 5.2358

>NTDB_id=284799 ECRM9975_RS25865 WP_000168305.1 4874985..4875521(+) (ssb) [Escherichia coli strain RM9975]
MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYI
EGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGAPAGGNIGGGQPQGGWGQPQQPQGGNQFSGGAQSRPQQSA
PAAPSNEPPMDFDDDIPF

Nucleotide


Download         Length: 537 bp        

>NTDB_id=284799 ECRM9975_RS25865 WP_000168305.1 4874985..4875521(+) (ssb) [Escherichia coli strain RM9975]
ATGGCCAGCAGAGGCGTAAACAAGGTTATTCTCGTTGGTAATCTGGGTCAGGACCCGGAAGTACGCTACATGCCAAATGG
TGGCGCAGTTGCCAACATTACGCTGGCTACTTCCGAATCCTGGCGTGATAAAGCGACCGGCGAGATGAAAGAACAGACTG
AATGGCACCGCGTTGTGCTGTTCGGCAAACTGGCAGAAGTGGCGAGCGAATATCTGCGTAAAGGTTCTCAGGTTTATATC
GAAGGTCAGCTGCGTACCCGTAAATGGACCGATCAATCCGGTCAGGATCGCTACACCACAGAAGTCGTGGTGAACGTTGG
CGGCACCATGCAGATGCTGGGTGGTCGTCAGGGTGGTGGCGCTCCGGCAGGTGGCAATATCGGTGGTGGTCAGCCGCAGG
GCGGTTGGGGTCAGCCACAGCAGCCGCAGGGTGGCAATCAGTTCAGCGGCGGCGCGCAGTCTCGCCCGCAGCAGTCCGCT
CCGGCAGCGCCGTCTAACGAGCCGCCGATGGACTTTGATGATGACATTCCGTTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

74.444

100

0.753

  ssb Glaesserella parasuis strain SC1401

57.923

100

0.596

  ssb Neisseria meningitidis MC58

48.066

100

0.489

  ssb Neisseria gonorrhoeae MS11

48.066

100

0.489


Multiple sequence alignment