Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   C7M22_RS19920 Genome accession   NZ_CP028208
Coordinates   4020989..4021426 (-) Length   145 a.a.
NCBI ID   WP_012117983.1    Uniprot ID   -
Organism   Bacillus velezensis strain SRCM102744     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 4015989..4026426
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M22_RS19870 (C7M22_04008) sinI 4016373..4016546 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  C7M22_RS19875 (C7M22_04009) sinR 4016580..4016915 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  C7M22_RS19880 (C7M22_04010) tasA 4016963..4017748 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  C7M22_RS19885 (C7M22_04011) sipW 4017813..4018397 (-) 585 WP_160223172.1 signal peptidase I SipW -
  C7M22_RS19890 (C7M22_04012) tapA 4018369..4019040 (-) 672 WP_160223173.1 amyloid fiber anchoring/assembly protein TapA -
  C7M22_RS19895 (C7M22_04013) - 4019299..4019628 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  C7M22_RS19900 (C7M22_04014) - 4019668..4019847 (-) 180 WP_160223174.1 YqzE family protein -
  C7M22_RS19905 (C7M22_04015) comGG 4019904..4020281 (-) 378 WP_160223175.1 competence type IV pilus minor pilin ComGG Machinery gene
  C7M22_RS19910 (C7M22_04016) comGF 4020282..4020782 (-) 501 WP_257474763.1 competence type IV pilus minor pilin ComGF -
  C7M22_RS19915 (C7M22_04017) comGE 4020691..4021005 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  C7M22_RS19920 (C7M22_04018) comGD 4020989..4021426 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  C7M22_RS19925 (C7M22_04019) comGC 4021416..4021682 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  C7M22_RS19930 (C7M22_04020) comGB 4021729..4022766 (-) 1038 WP_061582071.1 competence type IV pilus assembly protein ComGB Machinery gene
  C7M22_RS19935 (C7M22_04021) comGA 4022753..4023823 (-) 1071 WP_043020785.1 competence type IV pilus ATPase ComGA Machinery gene
  C7M22_RS19940 (C7M22_04022) - 4024020..4024970 (-) 951 WP_160223176.1 magnesium transporter CorA family protein -
  C7M22_RS19945 (C7M22_04023) - 4025116..4026417 (+) 1302 WP_012117986.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16286.74 Da        Isoelectric Point: 10.2475

>NTDB_id=282828 C7M22_RS19920 WP_012117983.1 4020989..4021426(-) (comGD) [Bacillus velezensis strain SRCM102744]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=282828 C7M22_RS19920 WP_012117983.1 4020989..4021426(-) (comGD) [Bacillus velezensis strain SRCM102744]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGACTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTTCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.849

100

0.572


Multiple sequence alignment