Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | C7M22_RS19870 | Genome accession | NZ_CP028208 |
| Coordinates | 4016373..4016546 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain SRCM102744 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 4011373..4021546
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C7M22_RS19855 (C7M22_04005) | gcvT | 4012186..4013286 (-) | 1101 | WP_032866432.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| C7M22_RS19860 (C7M22_04006) | - | 4013710..4015380 (+) | 1671 | WP_124934996.1 | DEAD/DEAH box helicase | - |
| C7M22_RS19865 (C7M22_04007) | - | 4015402..4016196 (+) | 795 | WP_076424968.1 | YqhG family protein | - |
| C7M22_RS19870 (C7M22_04008) | sinI | 4016373..4016546 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| C7M22_RS19875 (C7M22_04009) | sinR | 4016580..4016915 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| C7M22_RS19880 (C7M22_04010) | tasA | 4016963..4017748 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| C7M22_RS19885 (C7M22_04011) | sipW | 4017813..4018397 (-) | 585 | WP_160223172.1 | signal peptidase I SipW | - |
| C7M22_RS19890 (C7M22_04012) | tapA | 4018369..4019040 (-) | 672 | WP_160223173.1 | amyloid fiber anchoring/assembly protein TapA | - |
| C7M22_RS19895 (C7M22_04013) | - | 4019299..4019628 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| C7M22_RS19900 (C7M22_04014) | - | 4019668..4019847 (-) | 180 | WP_160223174.1 | YqzE family protein | - |
| C7M22_RS19905 (C7M22_04015) | comGG | 4019904..4020281 (-) | 378 | WP_160223175.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| C7M22_RS19910 (C7M22_04016) | comGF | 4020282..4020782 (-) | 501 | WP_257474763.1 | competence type IV pilus minor pilin ComGF | - |
| C7M22_RS19915 (C7M22_04017) | comGE | 4020691..4021005 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| C7M22_RS19920 (C7M22_04018) | comGD | 4020989..4021426 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=282825 C7M22_RS19870 WP_003153105.1 4016373..4016546(+) (sinI) [Bacillus velezensis strain SRCM102744]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=282825 C7M22_RS19870 WP_003153105.1 4016373..4016546(+) (sinI) [Bacillus velezensis strain SRCM102744]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |