Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | D9Y32_RS11430 | Genome accession | NZ_CP033218 |
| Coordinates | 2239810..2239950 (+) | Length | 46 a.a. |
| NCBI ID | WP_003184860.1 | Uniprot ID | A0ABM6LMF9 |
| Organism | Bacillus licheniformis strain TCCC 11148 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2234810..2244950
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D9Y32_RS11400 (D9Y32_11410) | - | 2234912..2235313 (+) | 402 | WP_003184870.1 | YueI family protein | - |
| D9Y32_RS11405 (D9Y32_11415) | - | 2235498..2236049 (+) | 552 | WP_003184868.1 | cysteine hydrolase family protein | - |
| D9Y32_RS11410 (D9Y32_11420) | - | 2236067..2237536 (+) | 1470 | WP_003184866.1 | nicotinate phosphoribosyltransferase | - |
| D9Y32_RS11415 (D9Y32_11425) | - | 2237715..2238934 (+) | 1220 | Protein_2215 | EAL and HDOD domain-containing protein | - |
| D9Y32_RS11420 (D9Y32_11430) | - | 2238977..2239324 (-) | 348 | WP_009329512.1 | hypothetical protein | - |
| D9Y32_RS11430 (D9Y32_11440) | degQ | 2239810..2239950 (+) | 141 | WP_003184860.1 | degradation enzyme regulation protein DegQ | Regulator |
| D9Y32_RS11435 (D9Y32_11445) | comQ | 2240139..2241020 (+) | 882 | WP_009329511.1 | polyprenyl synthetase family protein | Regulator |
| D9Y32_RS11440 (D9Y32_11450) | comX | 2241024..2241197 (+) | 174 | WP_142782424.1 | competence pheromone ComX | - |
| D9Y32_RS11445 (D9Y32_11455) | comP | 2241199..2243499 (+) | 2301 | WP_009329509.1 | ATP-binding protein | Regulator |
| D9Y32_RS11450 (D9Y32_11460) | comA | 2243586..2244224 (+) | 639 | WP_003184849.1 | response regulator transcription factor | Regulator |
| D9Y32_RS11455 (D9Y32_11465) | - | 2244241..2244630 (+) | 390 | WP_009329508.1 | hotdog fold thioesterase | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5747.56 Da Isoelectric Point: 8.4596
>NTDB_id=282711 D9Y32_RS11430 WP_003184860.1 2239810..2239950(+) (degQ) [Bacillus licheniformis strain TCCC 11148]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
Nucleotide
Download Length: 141 bp
>NTDB_id=282711 D9Y32_RS11430 WP_003184860.1 2239810..2239950(+) (degQ) [Bacillus licheniformis strain TCCC 11148]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
71.429 |
91.304 |
0.652 |