Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   D9Y32_RS11430 Genome accession   NZ_CP033218
Coordinates   2239810..2239950 (+) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   A0ABM6LMF9
Organism   Bacillus licheniformis strain TCCC 11148     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2234810..2244950
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9Y32_RS11400 (D9Y32_11410) - 2234912..2235313 (+) 402 WP_003184870.1 YueI family protein -
  D9Y32_RS11405 (D9Y32_11415) - 2235498..2236049 (+) 552 WP_003184868.1 cysteine hydrolase family protein -
  D9Y32_RS11410 (D9Y32_11420) - 2236067..2237536 (+) 1470 WP_003184866.1 nicotinate phosphoribosyltransferase -
  D9Y32_RS11415 (D9Y32_11425) - 2237715..2238934 (+) 1220 Protein_2215 EAL and HDOD domain-containing protein -
  D9Y32_RS11420 (D9Y32_11430) - 2238977..2239324 (-) 348 WP_009329512.1 hypothetical protein -
  D9Y32_RS11430 (D9Y32_11440) degQ 2239810..2239950 (+) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  D9Y32_RS11435 (D9Y32_11445) comQ 2240139..2241020 (+) 882 WP_009329511.1 polyprenyl synthetase family protein Regulator
  D9Y32_RS11440 (D9Y32_11450) comX 2241024..2241197 (+) 174 WP_142782424.1 competence pheromone ComX -
  D9Y32_RS11445 (D9Y32_11455) comP 2241199..2243499 (+) 2301 WP_009329509.1 ATP-binding protein Regulator
  D9Y32_RS11450 (D9Y32_11460) comA 2243586..2244224 (+) 639 WP_003184849.1 response regulator transcription factor Regulator
  D9Y32_RS11455 (D9Y32_11465) - 2244241..2244630 (+) 390 WP_009329508.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=282711 D9Y32_RS11430 WP_003184860.1 2239810..2239950(+) (degQ) [Bacillus licheniformis strain TCCC 11148]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=282711 D9Y32_RS11430 WP_003184860.1 2239810..2239950(+) (degQ) [Bacillus licheniformis strain TCCC 11148]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652